TkA08G175530 | RubberDandelionOmics

Gene overview

TkA08G175530

Reference: TK1151 Chr: Chr08 Coordinates: 45927279-45929027 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · TkA08G175530|TK1151|cDNA

ATGGTGAAGTATTCAAAGGAACCGGACAACCCTACCAAATCTTGCAAAGCAAGAGGATCAGATCTCAGGTGTCATTTTAAGATAGCATATAATGTTGCTGTAAAATGTGCTACAATCACACCTGATGAGACAAGAGTTAAAGAATTTGGGTTGAAGTCCATGTGGAGGAGTCGCAATGGCACAATCAGGAATATTTTAGATGGGACGGTTTTTCGTGAGCCAATTATGTGCAAAAATGTTCCTAGACTAGTCCCAGTTGC...

CDS

Download CDS FASTA

585 bp · TkA08G175530|TK1151|CDS

ATGGTGAAGTATTCAAAGGAACCGGACAACCCTACCAAATCTTGCAAAGCAAGAGGATCAGATCTCAGGTGTCATTTTAAGATAGCATATAATGTTGCTGTAAAATGTGCTACAATCACACCTGATGAGACAAGAGTTAAAGAATTTGGGTTGAAGTCCATGTGGAGGAGTCGCAATGGCACAATCAGGAATATTTTAGATGGGACGGTTTTTCGTGAGCCAATTATGTGCAAAAATGTTCCTAGACTAGTCCCAGTTGC...

Protein

Download Protein FASTA

194 aa · TkA08G175530|TK1151|PROTEIN

MVKYSKEPDNPTKSCKARGSDLRCHFKIAYNVAVKCATITPDETRVKEFGLKSMWRSRNGTIRNILDGTVFREPIMCKNVPRLVPVATTTGQDSWKFASALMAIYIGGAINYVAVSEALGVSPSVVAARLNFNLELEPQLEALVGRHSRKLWSKFMNAYNQHLVSPEAIDSLDKLLCYDHQDRLTAKEAMVTYF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G175530`
TK1151 ID	TkA08G175530
OH-1004 ID	LXL04_032437
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 97.423 / OH-1004 47.044 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G175530

Location Chr08:45927279-45929027 (+)

Description Similar to CKA1: Casein kinase II subunit alpha-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14590`	May be involved in response to oxidative stresses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032437 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009908 flower development Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0051726 regulation of cell cycle Biological Process

KEGG gene cross-reference

ath:AT2G23080

ath:AT3G50000

ath:AT5G67380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.422

Rank 1 · TkA08G175530 · TK1151

Nucleus0.350

Rank 2 · TkA08G175530 · TK1151

Mitochondrion0.158

Rank 3 · TkA08G175530 · TK1151

Cell membrane0.087

Rank 4 · TkA08G175530 · TK1151

Extracellular0.061

Rank 5 · TkA08G175530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05684DUF81990-130 aa

PF01642MM_CoA_mutase99-160 aa

PF13404HTH_AsnC-type109-130 aa

PF13412HTH_24110-131 aa

PF27660SCI1_hairpin140-162 aa

PF00069Pkinase155-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G175530	`PF05684`	DUF819	90	130	2.5e-10	40.7
TkA08G175530	`PF01642`	MM_CoA_mutase	99	160	0.099	11.7
TkA08G175530	`PF13404`	HTH_AsnC-type	109	130	0.11	13.1
TkA08G175530	`PF13412`	HTH_24	110	131	0.13	12.5
TkA08G175530	`PF27660`	SCI1_hairpin	140	162	0.002	18.5
TkA08G175530	`PF00069`	Pkinase	155	191	0.015	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPJ5`	Arabidopsis thaliana	sp\|Q8LPJ5\|ICDHP_ARATH Isocitrate dehydrogenase [NADP], chloroplastic/mitochondrial	87.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card