TkA08G175300 | RubberDandelionOmics

Gene overview

TkA08G175300

Reference: TK1151 Chr: Chr08 Coordinates: 45870603-45874341 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1776 bp · TkA08G175300|TK1151|cDNA

CTGTAGGGACTATAAATGAAGCTTTTAAAAAAGTAAAAGGTATTTTACTTCTAACTAGTTTACGCGTTATAAGAGAAAACACTCGTTCTCTTTTGAGAGACTCAACATCTGTCCGCCAGCCATGGAAGGAGCGCTACAGGTGGAAGAGCTGACCTCCGGCGCCAGCGGCCGTATCATCCCCGTCTTCAAGAACGTTCGCCGATCGGTGTTTTCTTCAGCCTCAATCCGCCGTGCACTGATTTTCTTCCAATCAATCTTTC...

CDS

Download CDS FASTA

1194 bp · TkA08G175300|TK1151|CDS

ATGGAAGGAGCGCTACAGGTGGAAGAGCTGACCTCCGGCGCCAGCGGCCGTATCATCCCCGTCTTCAAGAACGTTCGCCGATCGGTGTTTTCTTCAGCCTCAATCCGCCGTGCACTGATTTTCTTCCAATCAATCTTTCTGTGGTTCATTTTTCATCTTCGTCGTTGTCAACAGCACCATCGCCATCCATCTCCTCCGTCATCTCCTTCCTCGAAACGGAAGTTTCCTTTCAGGAGGAGAGAAATTGAGGAGGATGTTCT...

Protein

Download Protein FASTA

397 aa · TkA08G175300|TK1151|PROTEIN

MEGALQVEELTSGASGRIIPVFKNVRRSVFSSASIRRALIFFQSIFLWFIFHLRRCQQHHRHPSPPSSPSSKRKFPFRRREIEEDVLRRRALAEEIQMVKSSIDDDWTSQCHATTSLFFGTGRNALFCRSWLPVSEEIRGILIIIHGLNEHSGRYADFARQLNSSNFGVYAMDWIGHGGSDGLHGYVPSLDHVVADTGSFLEKIKGDHPGTPCFLYGHSTGGSVVLKAASYPYIESLVEGIIITSPALRVTPAHPIVGAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G175300`
TK1151 ID	TkA08G175300
OH-1004 ID	LXL04_032436
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 60.856 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G175300`
Location	Chr08:45870603-45874341 (-)
Description	Similar to SHR: Protein SHORT-ROOT
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032436` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0008356 asymmetric cell division Biological Process GO:0009956 radial pattern formation Biological Process GO:0032350 regulation of hormone metabolic process Biological Process GO:0045930 negative regulation of mitotic cell cycle Biological Process GO:0048366 leaf development Biological Process GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process GO:0005634 nucleus Cellular Component GO:0005769 early endosome Cellular Component GO:0005770 late endosome Cellular Component GO:0055037 recycling endosome Cellular Component
KEGG gene cross-reference	ath:AT4G37650 dosa:Os03g0433200 dosa:Os07g0586900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.309

Rank 1 · TkA08G175300 · TK1151

Golgi apparatus0.170

Rank 2 · TkA08G175300 · TK1151

Cytoplasm0.156

Rank 3 · TkA08G175300 · TK1151

Nucleus0.146

Rank 4 · TkA08G175300 · TK1151

Cell membrane0.106

Rank 5 · TkA08G175300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06269DUF102938-53 aa

PF12697Abhydrolase_675-93 aa

PF10230LIDHydrolase93-121 aa

PF12146Hydrolase_4137-375 aa

PF00561Abhydrolase_1141-373 aa

PF12697Abhydrolase_6142-348 aa

PF10230LIDHydrolase155-243 aa

PF01764Lipase_3185-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G175300	`PF06269`	DUF1029	38	53	0.26	12.2
TkA08G175300	`PF12697`	Abhydrolase_6	75	93	7.5e-15	56.9
TkA08G175300	`PF10230`	LIDHydrolase	93	121	0.059	13.8
TkA08G175300	`PF12146`	Hydrolase_4	137	375	3.2e-72	243.4
TkA08G175300	`PF00561`	Abhydrolase_1	141	373	5.4e-14	53.2
TkA08G175300	`PF12697`	Abhydrolase_6	142	348	7.5e-15	56.9
TkA08G175300	`PF10230`	LIDHydrolase	155	243	0.059	13.8
TkA08G175300	`PF01764`	Lipase_3	185	258	0.14	12.8
TkA08G175300	`PF12740`	PETase	188	231	0.054	13.7
TkA08G175300	`PF12740`	PETase	319	389	0.054	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card