RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G174580
Reference: TK1151 Chr: Chr08 Coordinates: 45658033-45660507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1113 bp · TkA08G174580|TK1151|cDNA

ATGAAATTTGATGGGCCAATCATTGTGGGCGCTGGCCCTTCTGGCATAGCAGTTGCAGCTTGCCTTAAGCATAAAACTTATGATCGTTTGAAGCTTCATCTTCCTAAACAATTCTGCGAGCTTCCATTGTTTGGGTACCCAAAGAATTTCCCAAAGTACCCGACGAAAAAACAGTTTGTTTCTTATATGGAGGCATACGCAAAGCACTTTGAAATCAAACCGAAGTTCAACCAATCGGTGTCTAGAGCAGAGTTTGACGT...

CDS

Download CDS FASTA

1113 bp · TkA08G174580|TK1151|CDS

ATGAAATTTGATGGGCCAATCATTGTGGGCGCTGGCCCTTCTGGCATAGCAGTTGCAGCTTGCCTTAAGCATAAAACTTATGATCGTTTGAAGCTTCATCTTCCTAAACAATTCTGCGAGCTTCCATTGTTTGGGTACCCAAAGAATTTCCCAAAGTACCCGACGAAAAAACAGTTTGTTTCTTATATGGAGGCATACGCAAAGCACTTTGAAATCAAACCGAAGTTCAACCAATCGGTGTCTAGAGCAGAGTTTGACGT...

Protein

Download Protein FASTA

370 aa · TkA08G174580|TK1151|PROTEIN

MKFDGPIIVGAGPSGIAVAACLKHKTYDRLKLHLPKQFCELPLFGYPKNFPKYPTKKQFVSYMEAYAKHFEIKPKFNQSVSRAEFDVQVGVWRVNTQDSVYESRWLVVATGENAEAVVPEIQGIDKFEGVVRHTSEYKSGCEFRKQRVLVVGCGNSGMEVSLDLCRYNASPFMVVRNSVHVLPREMFGFPTFGIAMGLLKWLPLRVVDKFILFMANLTLGSTDKLGLRRPKTGPLELKNATGKTPVLDTGALSLIKSGNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G174580
TK1151 IDTkA08G174580
OH-1004 IDLXL04_025866
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)58.000
Protein coverage (%)TK1151 95.946 / OH-1004 88.993
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G174580
LocationChr08:45658033-45660507 (+)
DescriptionSimilar to YUC6: Indole-3-pyruvate monooxygenase YUCCA6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g11320 Involved in auxin biosynthesis.
Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
At4g32540 Involved in auxin biosynthesis, but not in the tryptamine or the CYP79B2/B3 branches.
A role for flavin monooxygenase-like enzymes in auxin biosynthesis.2001 · DOI: 10.1126/science.291.5502.306
Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
Reassessing the role of N-hydroxytryptamine in auxin biosynthesis.2010 · DOI: 10.1104/pp.110.165803
Allelic analyses of the Arabidopsis YUC1 locus reveal residues and domains essential for the functions of YUC family of flavin monooxygenases.2011 · DOI: 10.1111/j.1744-7909.2010.01007.x
Conversion of tryptophan to indole-3-acetic acid by TRYPTOPHAN AMINOTRANSFERASES OF ARABIDOPSIS and YUCCAs in Arabidopsis.2011 · DOI: 10.1073/pnas.1108436108
The main auxin biosynthesis pathway in Arabidopsis.2011 · DOI: 10.1073/pnas.1108434108
The Arabidopsis YUCCA1 flavin monooxygenase functions in the indole-3-pyruvic acid branch of auxin biosynthesis.2011 · DOI: 10.1105/tpc.111.088047
At4g13260 Involved in auxin biosynthesis.
Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
At1g04180 Involved in auxin biosynthesis. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0645400 Involved in auxin biosynthesis.
Auxin biosynthesis by the YUCCA genes in rice.2007 · DOI: 10.1104/pp.106.091561
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025866 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006979 response to oxidative stress Biological Process
GO:0009635 response to herbicide Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009819 drought recovery Biological Process
GO:0009851 auxin biosynthetic process Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010262 somatic embryogenesis Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference
ath:AT1G04180
ath:AT1G04610
ath:AT4G13260
ath:AT5G11320
ath:AT5G25620
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.292
Rank 1 · TkA08G174580 · TK1151
Mitochondrion0.226
Rank 2 · TkA08G174580 · TK1151
Endoplasmic reticulum0.139
Rank 3 · TkA08G174580 · TK1151
Nucleus0.120
Rank 4 · TkA08G174580 · TK1151
Peroxisome0.112
Rank 5 · TkA08G174580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13738Pyr_redox_37-28 aa
PF07992Pyr_redox_27-182 aa
PF13434Lys_Orn_oxgnase7-26 aa
PF13454NAD_binding_97-33 aa
PF00070Pyr_redox7-24 aa
PF03486HI0933_like7-25 aa
PF01134GIDA7-24 aa
PF01266DAO7-23 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G174580PF13738Pyr_redox_37282.6e-2796.6
TkA08G174580PF07992Pyr_redox_271821.2e-1455.1
TkA08G174580PF13434Lys_Orn_oxgnase7261.7e-1351.1
TkA08G174580PF13454NAD_binding_97332.1e-0525.2
TkA08G174580PF00070Pyr_redox7240.000521.2
TkA08G174580PF03486HI0933_like7250.0005420.3
TkA08G174580PF01134GIDA7240.005316.6
TkA08G174580PF01266DAO7230.0215.2
TkA08G174580PF01946Thi47250.2311.4
TkA08G174580PF01494FAD_binding_37230.2411.3
TkA08G174580PF13450NAD_binding_88270.212.7
TkA08G174580PF00743FMO-like413011.8e-2280.2
TkA08G174580PF03486HI0933_like501140.0005420.3
TkA08G174580PF13738Pyr_redox_3521782.6e-2796.6
TkA08G174580PF13434Lys_Orn_oxgnase521671.7e-1351.1
TkA08G174580PF13454NAD_binding_9531112.1e-0525.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LFM5Arabidopsis thalianasp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA470.400%Swiss-ProtHigh
Q9SZY8Arabidopsis thalianasp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA163.900%Swiss-ProtHigh
Q9SVQ1Arabidopsis thalianasp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA258.100%Swiss-ProtHigh
O64489Arabidopsis thalianasp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA955.000%Swiss-ProtHigh
A0A0P0V5U9Oryza sativa subsp. japonicasp|A0A0P0V5U9|YUC1_ORYSJ Indole-3-pyruvate monooxygenase YUCCA160.500%Swiss-ProtHigh

JBrowse

View in Genome Browser