Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4697 bp · TkA08G170880|TK1151|cDNA
GGTAAAGAAAAAAACAGAGGTGCAAGGGAAATCTCTCTTTTTTCGCGCAGGGTTTCCAGAAATTCCTCCAATCCTAACCGGGAGAAAGGAGATTTGAAACACAGAAACTGGTCATCATCAGGTCAAGTATCTATCACTGTCTTAATTTTGTTTATGATTACATATACAGACCCTCGCACGCCCATGAACTTCAGATTTACTGAAACCCTAATACCCAATTCACCCCGCAGTTGTAAGTTTTATTAGAATTTGGTTTCTGT...
4032 bp · TkA08G170880|TK1151|CDS
ATGAGTAGTTTAGTTGAGAGACTTCGTGTTAGATCAGACTCAAGGCCCCGCTATAGTATAGACGATTCTGATGATGAGTCAGACCTCCTTCTAGGGAAATCCAAGAACAAAGAGCAGTTTGAGAAGATCATCAGAGATGACGCGAAAGAGGATTCATGTAATGCATGTGGTGAATCCGGGAATCTACTCATCTGTGAAACTTGCACTTATGAATACCATCCAAAGTGTCTACTACCACCTCTAAAAGCCCCTCTTCCTAC...
Protein
Download Protein FASTA1343 aa · TkA08G170880|TK1151|PROTEIN
MSSLVERLRVRSDSRPRYSIDDSDDESDLLLGKSKNKEQFEKIIRDDAKEDSCNACGESGNLLICETCTYEYHPKCLLPPLKAPLPTSWRCPKCVNPLNDIEKLLDCEMRPTVADDSDASKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFIKAYKELPRLRTKVNNFRKQMNVGNNEDDYVPIRPEYTMVDRVLACRQEEDEEKEYLVKWVGLNYDECYWESESDISSFQQQIENFNRLQSRHRKLRKQKSNNQDAID...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G170880 |
|---|---|
| TK1151 ID | TkA08G170880 |
| OH-1004 ID | LXL04_032392 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G170880 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:44705863-44714079 (-) | |||||||||
| Description | Similar to PKL: CHD3-type chromatin-remodeling factor PICKLE | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007051 spindle organization Biological Process GO:0007098 centrosome cycle Biological Process GO:0009414 response to water deprivation Biological Process GO:0009733 response to auxin Biological Process GO:0009736 cytokinin-activated signaling pathway Biological Process GO:0009739 response to gibberellin Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G25170 ath:AT4G31900 hsa:1107 hsa:1108 mmu:107932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13832zf-HC5HC2H_236-77 aaPF13771zf-HC5HC2H39-77 aaPF03107C1_248-76 aaPF23011PHD-1st_NSD49-77 aaPF00130C1_149-77 aaPF12773DZR49-76 aaPF22908PHD_NSD50-79 aaPF23004PHDvar_NSD52-82 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G170880 | PF13832 | zf-HC5HC2H_2 | 36 | 77 | 0.11 | 13.4 |
| TkA08G170880 | PF13771 | zf-HC5HC2H | 39 | 77 | 0.0055 | 17.6 |
| TkA08G170880 | PF03107 | C1_2 | 48 | 76 | 0.3 | 12.2 |
| TkA08G170880 | PF23011 | PHD-1st_NSD | 49 | 77 | 0.014 | 16.2 |
| TkA08G170880 | PF00130 | C1_1 | 49 | 77 | 0.096 | 13.2 |
| TkA08G170880 | PF12773 | DZR | 49 | 76 | 6.8 | 7.7 |
| TkA08G170880 | PF22908 | PHD_NSD | 50 | 79 | 0.25 | 12.4 |
| TkA08G170880 | PF23004 | PHDvar_NSD | 52 | 82 | 0.46 | 11.2 |
| TkA08G170880 | PF00628 | PHD | 53 | 94 | 1.2e-07 | 32.3 |
| TkA08G170880 | PF16866 | PHD_4 | 57 | 95 | 0.00088 | 19.9 |
| TkA08G170880 | PF03107 | C1_2 | 87 | 108 | 0.3 | 12.2 |
| TkA08G170880 | PF12773 | DZR | 90 | 98 | 6.8 | 7.7 |
| TkA08G170880 | PF23615 | Chromo_MIT1 | 102 | 148 | 2.6e-06 | 28.5 |
| TkA08G170880 | PF00385 | Chromo | 124 | 155 | 5.5e-25 | 87.8 |
| TkA08G170880 | PF26014 | SH3_AEBP2_C | 130 | 153 | 0.063 | 13.6 |
| TkA08G170880 | PF26014 | SH3_AEBP2_C | 162 | 244 | 0.063 | 13.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.