TkA08G168140 | RubberDandelionOmics

Gene overview

TkA08G168140

Reference: TK1151 Chr: Chr08 Coordinates: 43936071-43936634 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkA08G168140|TK1151|cDNA

ATGGACCATCTAGATATGAAGCTAACAGAAACTCAGTATCTTAATATATTGCATTCAATGGATCAGGCTGTACATGTATTTAGTCGCAACCTTCGGATACTCTTCTGGAACCGAGCTGCAGAAAATCTATATGGTTACACACCTGATGAAGCTTGTGGGAAAATTGTGACGGAGCTTCTGGTGGAACCCAAAGATGCACCATTGGCTTTTTATCTCCTAGAACGGACCGTAAAGGGAGAGACTTGGGCTGGGGAGTTTCC...

CDS

Download CDS FASTA

477 bp · TkA08G168140|TK1151|CDS

ATGGACCATCTAGATATGAAGCTAACAGAAACTCAGTATCTTAATATATTGCATTCAATGGATCAGGCTGTACATGTATTTAGTCGCAACCTTCGGATACTCTTCTGGAACCGAGCTGCAGAAAATCTATATGGTTACACACCTGATGAAGCTTGTGGGAAAATTGTGACGGAGCTTCTGGTGGAACCCAAAGATGCACCATTGGCTTTTTATCTCCTAGAACGGACCGTAAAGGGAGAGACTTGGGCTGGGGAGTTTCC...

Protein

Download Protein FASTA

158 aa · TkA08G168140|TK1151|PROTEIN

MDHLDMKLTETQYLNILHSMDQAVHVFSRNLRILFWNRAAENLYGYTPDEACGKIVTELLVEPKDAPLAFYLLERTVKGETWAGEFPILNKRGDKFVVIATNTPFRDETRGIVGGMCVSSDTGPYHVGKPPRLGFDSQQSLQISIASKISNLVSISNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G168140`
TK1151 ID	TkA08G168140
OH-1004 ID	LXL04_032337
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.000
Protein coverage (%)	TK1151 98.101 / OH-1004 22.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G168140`
Location	Chr08:43936071-43936634 (+)
Description	Similar to SIS8: Probable serine/threonine-protein kinase SIS8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032337` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000165 MAPK cascade Biological Process GO:0001666 response to hypoxia Biological Process GO:0001845 phagolysosome assembly Biological Process GO:0002229 defense response to oomycetes Biological Process GO:0006909 phagocytosis Biological Process GO:0007165 signal transduction Biological Process GO:0009414 response to water deprivation Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009651 response to salt stress Biological Process GO:0009686 gibberellin biosynthetic process Biological Process GO:0009723 response to ethylene Biological Process
KEGG gene cross-reference	ath:AT1G08720 ath:AT1G73660 ath:AT5G03730 ddi:DDB_G0281899 ddi:DDB_G0289791 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.428

Rank 1 · TkA08G168140 · TK1151

Nucleus0.222

Rank 2 · TkA08G168140 · TK1151

Plastid0.201

Rank 3 · TkA08G168140 · TK1151

Mitochondrion0.121

Rank 4 · TkA08G168140 · TK1151

Peroxisome0.094

Rank 5 · TkA08G168140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08447PAS_38-23 aa

PF00989PAS12-115 aa

PF13188PAS_812-60 aa

PF17765MLTR_LBD13-46 aa

PF08448PAS_417-122 aa

PF12860PAS_717-59 aa

PF13426PAS_929-121 aa

PF08447PAS_333-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G168140	`PF08447`	PAS_3	8	23	8.4e-10	39.5
TkA08G168140	`PF00989`	PAS	12	115	1.5e-11	45.0
TkA08G168140	`PF13188`	PAS_8	12	60	4.4e-06	27.1
TkA08G168140	`PF17765`	MLTR_LBD	13	46	0.0044	17.8
TkA08G168140	`PF08448`	PAS_4	17	122	1.9e-09	38.5
TkA08G168140	`PF12860`	PAS_7	17	59	2.9e-05	24.9
TkA08G168140	`PF13426`	PAS_9	29	121	1.9e-10	41.6
TkA08G168140	`PF08447`	PAS_3	33	113	8.4e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card