TkA08G165160 | RubberDandelionOmics

Gene overview

TkA08G165160

Reference: TK1151 Chr: Chr08 Coordinates: 43141192-43146459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3802 bp · TkA08G165160|TK1151|cDNA

GTCACCCCTTAATTTACCTGAATAATCAAAAGACAAGATGAAAATGTATCAACCCTAAACTCACAACACTGTGAACTGCCTTCCCTTTCTATTCTCAACCTTCTTTCTTCAAATCGTCGTCTTTGTCATCGTCTTTGTTTTTTCAAACAAGCAACTTATTAGAGATGGTGAAGGTTCGGATGAACACGGCGGACGTGGCCGCGGAAGTCAAATGCTTGCGTCAATTAATCGGGATGCGATGTTCTAATGTCTACGACCTT...

CDS

Download CDS FASTA

1026 bp · TkA08G165160|TK1151|CDS

ATGGTGAAGGTTCGGATGAACACGGCGGACGTGGCCGCGGAAGTCAAATGCTTGCGTCAATTAATCGGGATGCGATGTTCTAATGTCTACGACCTTTCTCCTAAGACATATGTTTTCAAGTTGATGAATAGCAGTGGAGTTACTGAATCCGGAGAGAGTGAGAAGGTTTTACTGCTGATGGAAAGTGGTGTACGTTTGCATACCACTGAATACCTTAGGGATAAAAGTAATACTCCTTCTGGTTTCACTCTCAAATTGCG...

Protein

Download Protein FASTA

341 aa · TkA08G165160|TK1151|PROTEIN

MVKVRMNTADVAAEVKCLRQLIGMRCSNVYDLSPKTYVFKLMNSSGVTESGESEKVLLLMESGVRLHTTEYLRDKSNTPSGFTLKLRKHIRTRRLEDVRQLGYDRIILFQFGVGANAYYIILELYAQGNILLTDSEFMVLTLLRSHRDDDKGYAIMARHRYPVEICRVFERTDTAKLQATLTSFNNQEINNDQVDEGTGEIEAPEPQKKGSKKSGKSNVSSKKTNGANVKQTTLKVVLGDALGYGPALSEHIILDAGLTP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G165160`
TK1151 ID	TkA08G165160
OH-1004 ID	LXL04_032314
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.721 / OH-1004 29.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G165160`
Location	Chr08:43141192-43146459 (-)
Description	Similar to Nemf: Nuclear export mediator factor Nemf
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032314` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001680 tRNA 3'-terminal CCA addition Biological Process GO:0006611 protein export from nucleus Biological Process GO:0042780 tRNA 3'-end processing Biological Process GO:0051168 nuclear export Biological Process GO:0065003 protein-containing complex assembly Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway Biological Process GO:0140708 CAT tailing Biological Process GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	dme:Dmel_CG11847 hsa:9147 mmu:66244 spo:2538747 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.824

Rank 1 · TkA08G165160 · TK1151

Cytoplasm0.270

Rank 2 · TkA08G165160 · TK1151

Mitochondrion0.035

Rank 3 · TkA08G165160 · TK1151

Cell membrane0.016

Rank 4 · TkA08G165160 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA08G165160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05833NFACT_N11-149 aa

PF05833NFACT_N203-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G165160	`PF05833`	NFACT_N	11	149	1.3e-17	64.4
TkA08G165160	`PF05833`	NFACT_N	203	309	1.3e-17	64.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card