TkA08G164110 | RubberDandelionOmics

Gene overview

TkA08G164110

Reference: TK1151 Chr: Chr08 Coordinates: 42862953-42867168 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3169 bp · TkA08G164110|TK1151|cDNA

GTGGACACAACTTTTGACTTCCCTCTCTATTATATGTCTCTCCTTCTTGAAAACCTTTCTCTCTCGAGACTGACACACTTTGGCTCTAGGGTTTCCTCCTTAAGGAATCTTTGATTTTCGTTATATGATTATTTTTTTCATCTGGATTACATCAAGACGACTACCCTTCATGAGCGTTTGATTGATGGCTGGCACAAAATGTTACATTCCCAATCAATTGTTAGATTTGGATCAAATACAGCAAGAAGCAAAGCACCGAT...

CDS

Download CDS FASTA

2541 bp · TkA08G164110|TK1151|CDS

ATGGCTGGCACAAAATGTTACATTCCCAATCAATTGTTAGATTTGGATCAAATACAGCAAGAAGCAAAGCACCGATGGTTACGACCTGCTGAAATTTGTGAAATTCTAATAAACCATCAGAAGTTTAAACTGAGACCTAGTCCACCTGTCACGCCACCAGCTGGTTCTTTATTTCTCTTTGATCGAAAGTCGACTCGATATTTTCGTAAAGATGGACACCGTTGGAGGAAAAAGAAAGATGGGAAGATTGTTAAAGAAGC...

Protein

Download Protein FASTA

846 aa · TkA08G164110|TK1151|PROTEIN

MAGTKCYIPNQLLDLDQIQQEAKHRWLRPAEICEILINHQKFKLRPSPPVTPPAGSLFLFDRKSTRYFRKDGHRWRKKKDGKIVKEAHEKLKAGSVDVLHCYYAHGEDNENFQRRSYWMLDKQFENIVLVHYRDVKEGYKSGVLNEDSRRLIQNSESSEQTPHTTSYASDMNSIDINEQSVSSRFNNGHSSQDFRTHTPSFTTDFLSYKLTDATLDSDTSHDFFDAGLFPDSEVKVHVNEKSEALNLQDNDTKGLKKMDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G164110`
TK1151 ID	TkA08G164110
OH-1004 ID	LXL04_032302
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.173 / OH-1004 94.457 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G164110

Location Chr08:42862953-42867168 (+)

Description Similar to CAMTA2: Calmodulin-binding transcription activator 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22300`	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'.	Calmodulin-binding transcription activator (CAMTA) 3 mediates biotic defense responses in Arabidopsis.2008 · DOI: 10.1016/j.febslet.2008.02.037 Ca(2+)/calmodulin regulates salicylic-acid-mediated plant immunity.2009 · DOI: 10.1038/nature07612 Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance.2009 · DOI: 10.1105/tpc.108.063958 Brush and spray: a high-throughput systemic acquired resistance assay suitable for large-scale genetic screening.2011 · DOI: 10.1104/pp.111.182089 The calmodulin-binding transcription factor SIGNAL RESPONSIVE1 is a novel regulator of glucosinolate metabolism and herbivory tolerance in Arabidopsis.2012 · DOI: 10.1093/pcp/pcs143 Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205 A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.2014 · DOI: 10.1111/tpj.12620 Distinct roles for mitogen-activated protein kinase signaling and CALMODULIN-BINDING TRANSCRIPTIONAL ACTIVATOR3 in regulating the peak time and amplitude of the plant general stress response.2014 · DOI: 10.1104/pp.114.245944 Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.2017 · DOI: 10.1105/tpc.16.00669 Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005
`At5g64220`	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity).	Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205
`At5g09410`	Transcription activator that binds calmodulin in a calcium-dependent manner in vitro.	A novel family of calmodulin-binding transcription activators in multicellular organisms.2002 · DOI: 10.1074/jbc.m200268200 Arabidopsis CAMTA family proteins enhance V-PPase expression in pollen.2003 · DOI: 10.1093/pcp/pcg137 Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance.2009 · DOI: 10.1105/tpc.108.063958 Calmodulin-binding transcription activator 1 mediates auxin signaling and responds to stresses in Arabidopsis.2010 · DOI: 10.1007/s00425-010-1153-6 CAMTA 1 regulates drought responses in Arabidopsis thaliana.2013 · DOI: 10.1186/1471-2164-14-216 Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205
`At1g67310`	Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity).	No verified direct reference in this release
`At3g16940`	Transcription activator that binds calmodulin in a calcium-dependent manner in vitro.	A novel family of calmodulin-binding transcription activators in multicellular organisms.2002 · DOI: 10.1074/jbc.m200268200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032302 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009733 response to auxin Biological Process

GO:0010150 leaf senescence Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050826 response to freezing Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0070417 cellular response to cold Biological Process

KEGG gene cross-reference

ath:AT2G22300

ath:AT5G09410

ath:AT5G64220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.485

Rank 1 · TkA08G164110 · TK1151

Cytoplasm0.434

Rank 2 · TkA08G164110 · TK1151

Cell membrane0.116

Rank 3 · TkA08G164110 · TK1151

Mitochondrion0.050

Rank 4 · TkA08G164110 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA08G164110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03859CG-121-134 aa

PF12796Ank_231-39 aa

PF14699hGDE_N107-117 aa

PF01833TIG323-397 aa

PF17960TIG_plexin339-382 aa

PF12796Ank_2360-402 aa

PF14699hGDE_N362-398 aa

PF13857Ank_5516-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G164110	`PF03859`	CG-1	21	134	5.2e-48	162.3
TkA08G164110	`PF12796`	Ank_2	31	39	7.9e-10	39.9
TkA08G164110	`PF14699`	hGDE_N	107	117	0.062	14.2
TkA08G164110	`PF01833`	TIG	323	397	3e-07	31.1
TkA08G164110	`PF17960`	TIG_plexin	339	382	0.025	15.2
TkA08G164110	`PF12796`	Ank_2	360	402	7.9e-10	39.9
TkA08G164110	`PF14699`	hGDE_N	362	398	0.062	14.2
TkA08G164110	`PF13857`	Ank_5	516	527	0.21	12.8
TkA08G164110	`PF12796`	Ank_2	525	615	7.9e-10	39.9
TkA08G164110	`PF13637`	Ank_4	549	572	0.0014	19.6
TkA08G164110	`PF13857`	Ank_5	552	583	0.21	12.8
TkA08G164110	`PF00023`	Ank	553	576	1.1e-05	26.2
TkA08G164110	`PF13606`	Ank_3	553	575	3.5e-05	24.5
TkA08G164110	`PF13857`	Ank_5	589	611	0.21	12.8
TkA08G164110	`PF13637`	Ank_4	591	611	0.0014	19.6
TkA08G164110	`PF00023`	Ank	592	612	1.1e-05	26.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GSA7`	Arabidopsis thaliana	sp\|Q8GSA7\|CMTA3_ARATH Calmodulin-binding transcription activator 3	37.300%	Swiss-Prot	Medium
`Q6NPP4`	Arabidopsis thaliana	sp\|Q6NPP4\|CMTA2_ARATH Calmodulin-binding transcription activator 2	34.200%	Swiss-Prot	Medium
`Q9FY74`	Arabidopsis thaliana	sp\|Q9FY74\|CMTA1_ARATH Calmodulin-binding transcription activator 1	32.600%	Swiss-Prot	Medium
`Q9FYG2`	Arabidopsis thaliana	sp\|Q9FYG2\|CMTA4_ARATH Calmodulin-binding transcription activator 4	32.100%	Swiss-Prot	Medium
`Q9LSP8`	Arabidopsis thaliana	sp\|Q9LSP8\|CMTA6_ARATH Calmodulin-binding transcription activator 6	32.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card