TkA08G162400 | RubberDandelionOmics

Gene overview

TkA08G162400

Reference: TK1151 Chr: Chr08 Coordinates: 42388558-42390891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1178 bp · TkA08G162400|TK1151|cDNA

ATCTGATCCTATATTCGCGATAGAATATATATTCAGTTATTCACGATAGAATTGCAAACTGTATCTTTCCGAAAATCACGATTCATGGGGTTTAAACTAGTCGATCGCTGCTGTCTCATCGATACCGTACTCCAAAAACGCAGAAAAAACCCTAACCGCAGTGCCGGATCGTCGACAGATTAAGGTGAAAAGCGAGGGCCAATTGTTAAGTATCCCACCTAATGGCATCATATTCATCGCAAAAAGATGCATCGTCATCA...

CDS

Download CDS FASTA

471 bp · TkA08G162400|TK1151|CDS

ATGCAAAGTGGTAATCGGACCCGAACTTTGTCGATCCATCCTACCAAAAAAACAGCTTCAAAGATGGGAATTGAAGACGCATTGTGCGAGTCTCTGATCTTGGCGTCTCAGAAATTTTACTGTCCGTTTAAAAACTGTTCCGCCGTTTTGGTGGATGATGGTGGAGAAGTTGTGACATCGTCGGAATGCCCAAATTGCCATAGATTGTTCTGTGCGCAGTGTAAGGTGGCATGGCATTCTGGACTCGATTGCCGTGAGTT...

Protein

Download Protein FASTA

156 aa · TkA08G162400|TK1151|PROTEIN

MQSGNRTRTLSIHPTKKTASKMGIEDALCESLILASQKFYCPFKNCSAVLVDDGGEVVTSSECPNCHRLFCAQCKVAWHSGLDCREFKRLKKGDRNPEDFMLKKLAEKKKCQRCPKCKIYVAKRSGCNHITCRCGYEFCYGCGKKHHANHLCRLRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G162400`
TK1151 ID	TkA08G162400
OH-1004 ID	LXL04_032268
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.100
Protein coverage (%)	TK1151 84.615 / OH-1004 38.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G162400`
Location	Chr08:42388558-42390891 (+)
Description	Similar to ARI9: Probable E3 ubiquitin-protein ligase ARI9
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032268` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0002221 pattern recognition receptor signaling pathway Biological Process GO:0002753 cytoplasmic pattern recognition receptor signaling pathway Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0010431 seed maturation Biological Process GO:0010476 gibberellin mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0085020 protein K6-linked ubiquitination Biological Process GO:0140547 acquisition of seed longevity Biological Process
KEGG gene cross-reference	ath:AT2G26130 ath:AT2G31760 ath:AT2G31770 hsa:9781 mmu:108089 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · TkA08G162400 · TK1151

Cytoplasm0.249

Rank 2 · TkA08G162400 · TK1151

Endoplasmic reticulum0.040

Rank 3 · TkA08G162400 · TK1151

Cell membrane0.038

Rank 4 · TkA08G162400 · TK1151

Mitochondrion0.018

Rank 5 · TkA08G162400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01485IBR27-84 aa

PF22605IBR_246-79 aa

PF15470DUF463760-76 aa

PF22191IBR_161-83 aa

PF26200Rcat_RNF21661-73 aa

PF01485IBR98-152 aa

PF15470DUF4637102-126 aa

PF22191IBR_1110-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G162400	`PF01485`	IBR	27	84	5.4e-20	71.9
TkA08G162400	`PF22605`	IBR_2	46	79	5.4	8.0
TkA08G162400	`PF15470`	DUF4637	60	76	0.082	13.5
TkA08G162400	`PF22191`	IBR_1	61	83	1.4e-09	38.4
TkA08G162400	`PF26200`	Rcat_RNF216	61	73	2.9e-07	31.7
TkA08G162400	`PF01485`	IBR	98	152	5.4e-20	71.9
TkA08G162400	`PF15470`	DUF4637	102	126	0.082	13.5
TkA08G162400	`PF22191`	IBR_1	110	149	1.4e-09	38.4
TkA08G162400	`PF26200`	Rcat_RNF216	112	146	2.9e-07	31.7
TkA08G162400	`PF22605`	IBR_2	112	145	5.4	8.0
TkA08G162400	`PF15470`	DUF4637	132	147	0.082	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card