TkA08G160570 | RubberDandelionOmics

Gene overview

TkA08G160570

Reference: TK1151 Chr: Chr08 Coordinates: 41907083-41908393 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

998 bp · TkA08G160570|TK1151|cDNA

ATATATCTACCACCACTATGTCTCCCACAAAATCGGTAGCTTGTTTAGTACTACTCTTCTTCTCATCTACTTTGCTTTCACACACTGCATCCCGCTTGCTCCCCGAAAGCCACGAGCAATGGATGGCCCGTTATGGACGTGTGTACAAGGATGCTCATGAGAAAGAACAACGTTCAAATATCTTTCATGAGAACGTTCAATACATAGAGTCATCCAACAATGCCATGAACAAAGGATACAAACTAGCGGTCAATGAGTTT...

CDS

Download CDS FASTA

981 bp · TkA08G160570|TK1151|CDS

ATGTCTCCCACAAAATCGGTAGCTTGTTTAGTACTACTCTTCTTCTCATCTACTTTGCTTTCACACACTGCATCCCGCTTGCTCCCCGAAAGCCACGAGCAATGGATGGCCCGTTATGGACGTGTGTACAAGGATGCTCATGAGAAAGAACAACGTTCAAATATCTTTCATGAGAACGTTCAATACATAGAGTCATCCAACAATGCCATGAACAAAGGATACAAACTAGCGGTCAATGAGTTTGCAGACCTCACAAACGA...

Protein

Download Protein FASTA

327 aa · TkA08G160570|TK1151|PROTEIN

MSPTKSVACLVLLFFSSTLLSHTASRLLPESHEQWMARYGRVYKDAHEKEQRSNIFHENVQYIESSNNAMNKGYKLAVNEFADLTNEEFTTTRNRFKAHECSPSPSTFAFRYENVTVPTSMDWRKKGAVTPIKDQGQCGSCWAFSAVGAMEGVTQLKTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFDFILKNKGLTTETNYPYKASDGTCNNKEASNHAATITGHEDVPANSETSLLKAVSSQPISVAIDASGSDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G160570`
TK1151 ID	TkA08G160570
OH-1004 ID	LXL04_032237
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G160570

Location Chr08:41907083-41908393 (+)

Description Similar to OsI_14861: Senescence-specific cysteine protease SAG39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45890`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	Identification of a promoter region responsible for the senescence-specific expression of SAG12.1999 · DOI: 10.1023/a:1006342412688 HDA6 is required for jasmonate response, senescence and flowering in Arabidopsis.2008 · DOI: 10.1093/jxb/erm300 Natural developmental variations in leaf and plant senescence in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1438-8677.2008.00108.x Epigenetic programming via histone methylation at WRKY53 controls leaf senescence in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2008.03782.x Nitric oxide is involved in cadmium-induced programmed cell death in Arabidopsis suspension cultures.2009 · DOI: 10.1104/pp.108.133397

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XQE8`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release
`Os04g0206300`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release
`Os11g0255300`	Cysteine endopeptidase that digests in vitro both the acidic and basic subunits of glutelin, the major seed storage protein of rice.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010224 response to UV-B Biological Process

KEGG gene cross-reference

ath:AT5G45890

dosa:Os11g0255300

osa:107276017

osa:4350216

rcu:8278243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.614

Rank 1 · TkA08G160570 · TK1151

Extracellular0.207

Rank 2 · TkA08G160570 · TK1151

Cytoplasm0.189

Rank 3 · TkA08G160570 · TK1151

Endoplasmic reticulum0.120

Rank 4 · TkA08G160570 · TK1151

Cell membrane0.108

Rank 5 · TkA08G160570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246Inhibitor_I2932-89 aa

PF00112Peptidase_C1117-326 aa

PF03051Peptidase_C1_2130-151 aa

PF03051Peptidase_C1_2275-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G160570	`PF08246`	Inhibitor_I29	32	89	2.9e-18	66.6
TkA08G160570	`PF00112`	Peptidase_C1	117	326	4.4e-83	279.4
TkA08G160570	`PF03051`	Peptidase_C1_2	130	151	1.1e-05	25.2
TkA08G160570	`PF03051`	Peptidase_C1_2	275	315	1.1e-05	25.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ47`	Arabidopsis thaliana	sp\|Q9FJ47\|SAG12_ARATH Senescence-specific cysteine protease SAG12	57.100%	Swiss-Prot	High
`A2XQE8`	Oryza sativa subsp. indica	sp\|A2XQE8\|SAG39_ORYSI Senescence-specific cysteine protease SAG39	61.500%	Swiss-Prot	High
`Q7XWK5`	Oryza sativa subsp. japonica	sp\|Q7XWK5\|SAG39_ORYSJ Senescence-specific cysteine protease SAG39	61.200%	Swiss-Prot	High
`Q7GDU7`	Oryza sativa subsp. japonica	sp\|Q7GDU7\|REPA_ORYSJ Cysteine endopeptidase RepA	55.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card