RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G160550
Reference: TK1151 Chr: Chr08 Coordinates: 41895462-41896991 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1143 bp · TkA08G160550|TK1151|cDNA

TTTTCTCATATATCTACCGCCACTATGTCTTCCACAAAATCCTTGGCTTGTTTGGTTCTACTCTTCTTCTCATCTACCTTACTCTCACACACTGCATCCCGCATGCTCCCTGAAAGCCATGAGCAATGGATGGCTCGTTATGGACGTGTGTACAAGGATGCTAATGAGAAAGAACAACGCTCAAAGATCTTTCAAGAGAACGTTCAATACATAGAGTCCTCCAACAATGCCATGAACAGAGGCTACAAACTAGCAGTTAA...

CDS

Download CDS FASTA

1008 bp · TkA08G160550|TK1151|CDS

ATGTCTTCCACAAAATCCTTGGCTTGTTTGGTTCTACTCTTCTTCTCATCTACCTTACTCTCACACACTGCATCCCGCATGCTCCCTGAAAGCCATGAGCAATGGATGGCTCGTTATGGACGTGTGTACAAGGATGCTAATGAGAAAGAACAACGCTCAAAGATCTTTCAAGAGAACGTTCAATACATAGAGTCCTCCAACAATGCCATGAACAGAGGCTACAAACTAGCAGTTAATGAGTTTGCAGACCTCACAAACGA...

Protein

Download Protein FASTA

335 aa · TkA08G160550|TK1151|PROTEIN

MSSTKSLACLVLLFFSSTLLSHTASRMLPESHEQWMARYGRVYKDANEKEQRSKIFQENVQYIESSNNAMNRGYKLAVNEFADLTNEEFTTTRNRFKAHECSPSPSTSAFRYENVTVPKTMDWRKKGAVTPIKDQGQCGSCWAFSTVGAMEGITQLKTGKLISLSEQELVDCDTSGVDQGCEGGLMDDAFDFIIKNKGLTTENNYPYKAADGTCNTKEASNHAATITGHEDVPANSETSLLKAAASQPISVAIDASGSDF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G160550
TK1151 IDTkA08G160550
OH-1004 IDLXL04_032237
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)94.300
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G160550
LocationChr08:41895462-41896991 (+)
DescriptionSimilar to OsI_14861: Senescence-specific cysteine protease SAG39
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g45890 Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.
Identification of a promoter region responsible for the senescence-specific expression of SAG12.1999 · DOI: 10.1023/a:1006342412688
HDA6 is required for jasmonate response, senescence and flowering in Arabidopsis.2008 · DOI: 10.1093/jxb/erm300
Natural developmental variations in leaf and plant senescence in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1438-8677.2008.00108.x
Epigenetic programming via histone methylation at WRKY53 controls leaf senescence in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2008.03782.x
Nitric oxide is involved in cadmium-induced programmed cell death in Arabidopsis suspension cultures.2009 · DOI: 10.1104/pp.108.133397

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XQE8 Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response. No verified direct reference in this release
Os04g0206300 Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response. No verified direct reference in this release
Os11g0255300 Cysteine endopeptidase that digests in vitro both the acidic and basic subunits of glutelin, the major seed storage protein of rice. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009733 response to auxin Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0009744 response to sucrose Biological Process
GO:0009749 response to glucose Biological Process
GO:0009750 response to fructose Biological Process
GO:0010150 leaf senescence Biological Process
GO:0010224 response to UV-B Biological Process
KEGG gene cross-reference
ath:AT5G45890
dosa:Os11g0255300
osa:107276017
osa:4350216
rcu:8278243
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.611
Rank 1 · TkA08G160550 · TK1151
Extracellular0.220
Rank 2 · TkA08G160550 · TK1151
Cytoplasm0.195
Rank 3 · TkA08G160550 · TK1151
Endoplasmic reticulum0.118
Rank 4 · TkA08G160550 · TK1151
Cell membrane0.104
Rank 5 · TkA08G160550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16013DUF47816-67 aa
PF08246Inhibitor_I2932-89 aa
PF26325YhjD54-101 aa
PF03051Peptidase_C1_2114-150 aa
PF00112Peptidase_C1117-334 aa
PF03051Peptidase_C1_2275-315 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G160550PF16013DUF47816670.2111.1
TkA08G160550PF08246Inhibitor_I2932891.5e-1867.6
TkA08G160550PF26325YhjD541010.1113.0
TkA08G160550PF03051Peptidase_C1_21141501.8e-0627.8
TkA08G160550PF00112Peptidase_C11173341.6e-85287.4
TkA08G160550PF03051Peptidase_C1_22753151.8e-0627.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FJ47Arabidopsis thalianasp|Q9FJ47|SAG12_ARATH Senescence-specific cysteine protease SAG1257.400%Swiss-ProtHigh
A2XQE8Oryza sativa subsp. indicasp|A2XQE8|SAG39_ORYSI Senescence-specific cysteine protease SAG3962.500%Swiss-ProtHigh
Q7XWK5Oryza sativa subsp. japonicasp|Q7XWK5|SAG39_ORYSJ Senescence-specific cysteine protease SAG3962.200%Swiss-ProtHigh
Q7GDU7Oryza sativa subsp. japonicasp|Q7GDU7|REPA_ORYSJ Cysteine endopeptidase RepA55.200%Swiss-ProtHigh

JBrowse

View in Genome Browser