TkA08G154870 | RubberDandelionOmics

Gene overview

TkA08G154870

Reference: TK1151 Chr: Chr08 Coordinates: 40430977-40434484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2653 bp · TkA08G154870|TK1151|cDNA

CAACAACACGCACATGGAAATGAATTTGAAACTGCCACGTTGACTTGTTAAACCCACCTCGCCTGGGTGGAGGTGCAGGTCAGTTTGACCCAATTCCTACCCAAAACTTACGTAAAAGGAAAAGATTATGTCTAAATCAATTTTCATTACAAAATTGAAAATTGTGCTCCATTTGGCGTTAATCGGCAATACCCATTTGTTTAATTAGTTTTTCGAAACTAGAATTTAGGGGAAGTGTAGCGAAATCAGAAAAGGGCCGC...

CDS

Download CDS FASTA

2133 bp · TkA08G154870|TK1151|CDS

ATGGCTCACGGAAGAATCCGCGCAAAATTAAAACGAAGCAGTCTATACACCTTCGGAGGATGCATACGACCTCCACCAGAATCAACAGACGAGCCTCACCAATTCCGCGGGCCAGGTTTCTCCCGTCAAGTCTCCTGCAACCAACCTCAAATCCACCAAAAGAAACCCCTCAAATACTGCTCCAATTACATCTCGACCACAAAATACAACGTCATAACCTTCCTCCCAAAAGCCCTATTCGAACAATTCCGCCGGGTAGC...

Protein

Download Protein FASTA

711 aa · TkA08G154870|TK1151|PROTEIN

MAHGRIRAKLKRSSLYTFGGCIRPPPESTDEPHQFRGPGFSRQVSCNQPQIHQKKPLKYCSNYISTTKYNVITFLPKALFEQFRRVANVYFLLAAVLSLTPVSPFTPYSMIAPLAFVIGLSMAKEAVENWHRFMQDMKVNMRKVNVHNTEGLFSPKPWMNIRVGDVVKVEKDQFFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRSLEVTLSLDDDTSFKNFRALIKCEDPNPNLYTFVGNFEYERQLYPLDPSQIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G154870`
TK1151 ID	TkA08G154870
OH-1004 ID	LXL04_008258
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 99.297 / OH-1004 52.112 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G154870

Location Chr08:40430977-40434484 (-)

Description Similar to ALA4: Probable phospholipid-transporting ATPase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17500`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g72700`	Involved in transport of phospholipids.	No verified direct reference in this release
`At3g13900`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At1g54280`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At1g68710`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:1905038 regulation of membrane lipid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G17500

ath:AT1G54280

ath:AT1G72700

ath:AT3G13900

ath:AT3G25610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.400

Rank 1 · TkA08G154870 · TK1151

Endoplasmic reticulum0.287

Rank 2 · TkA08G154870 · TK1151

Golgi apparatus0.229

Rank 3 · TkA08G154870 · TK1151

Cytoplasm0.222

Rank 4 · TkA08G154870 · TK1151

Lysosome / Vacuole0.122

Rank 5 · TkA08G154870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209PhoLip_ATPase_N44-111 aa

PF01292Ni_hydr_CYTB88-133 aa

PF00122E1-E2_ATPase142-204 aa

PF01292Ni_hydr_CYTB288-371 aa

PF16209PhoLip_ATPase_N301-321 aa

PF13246Cation_ATPase536-688 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G154870	`PF16209`	PhoLip_ATPase_N	44	111	2e-26	92.2
TkA08G154870	`PF01292`	Ni_hydr_CYTB	88	133	0.26	11.8
TkA08G154870	`PF00122`	E1-E2_ATPase	142	204	0.085	13.4
TkA08G154870	`PF01292`	Ni_hydr_CYTB	288	371	0.26	11.8
TkA08G154870	`PF16209`	PhoLip_ATPase_N	301	321	2e-26	92.2
TkA08G154870	`PF13246`	Cation_ATPase	536	688	7.9e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNQ4`	Arabidopsis thaliana	sp\|Q9LNQ4\|ALA4_ARATH Probable phospholipid-transporting ATPase 4	69.000%	Swiss-Prot	High
`Q9SGG3`	Arabidopsis thaliana	sp\|Q9SGG3\|ALA5_ARATH Probable phospholipid-transporting ATPase 5	67.300%	Swiss-Prot	High
`Q9LVK9`	Arabidopsis thaliana	sp\|Q9LVK9\|ALA7_ARATH Probable phospholipid-transporting ATPase 7	66.800%	Swiss-Prot	High
`Q9SLK6`	Arabidopsis thaliana	sp\|Q9SLK6\|ALA6_ARATH Phospholipid-transporting ATPase 6	65.700%	Swiss-Prot	High
`Q9SX33`	Arabidopsis thaliana	sp\|Q9SX33\|ALA9_ARATH Putative phospholipid-transporting ATPase 9	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card