TkA08G154160 | RubberDandelionOmics

Gene overview

TkA08G154160

Reference: TK1151 Chr: Chr08 Coordinates: 40255531-40255983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

351 bp · TkA08G154160|TK1151|cDNA

ATGGCAACAAAATCGGAGAGGTTTTCTTCAGATTTTGTGATGGGAGGTGCACCAACCATAGTATCAAAAAGAGCAGCAACTCCAATTGAGAGAGTGAAGCTTGTACTGCAAAATCAAGGCGAGTTATTAAAAATGGGTCAACTCACGAGACCATATTCCGGGGTTGGTGAATGCTTTAAAAGGGTTCTGATCGAGAAGGAGCAGAGAAAAAAAAACAGAGTTGAGTGTGGTGGTGGTGGTCGTATGTGTCGGCAGGAAGA...

CDS

Download CDS FASTA

351 bp · TkA08G154160|TK1151|CDS

ATGGCAACAAAATCGGAGAGGTTTTCTTCAGATTTTGTGATGGGAGGTGCACCAACCATAGTATCAAAAAGAGCAGCAACTCCAATTGAGAGAGTGAAGCTTGTACTGCAAAATCAAGGCGAGTTATTAAAAATGGGTCAACTCACGAGACCATATTCCGGGGTTGGTGAATGCTTTAAAAGGGTTCTGATCGAGAAGGAGCAGAGAAAAAAAAACAGAGTTGAGTGTGGTGGTGGTGGTCGTATGTGTCGGCAGGAAGA...

Protein

Download Protein FASTA

116 aa · TkA08G154160|TK1151|PROTEIN

MATKSERFSSDFVMGGAPTIVSKRAATPIERVKLVLQNQGELLKMGQLTRPYSGVGECFKRVLIEKEQRKKNRVECGGGGRMCRQEDEERRWGKWLRKEEGGKNPDKSLKTRMKKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G154160`
TK1151 ID	TkA08G154160
OH-1004 ID	LXL04_008724
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.200
Protein coverage (%)	TK1151 56.034 / OH-1004 21.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G154160

Location Chr08:40255531-40255983 (-)

Description Similar to ER-ANT1: ADP,ATP carrier protein ER-ANT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17400`	ADP:ATP antiporter that catalyzes the exchange of ADP and ATP across the endoplasmic reticulum membrane.	Identification of a novel adenine nucleotide transporter in the endoplasmic reticulum of Arabidopsis.2008 · DOI: 10.1105/tpc.107.057554

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008724 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0048316 seed development Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

GO:0051503 adenine nucleotide transport Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005757 mitochondrial permeability transition pore complex Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005471 ATP:ADP antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G17400

cre:CHLRE_09g386650v5

mtm:MYCTH_2316753

vda:VDAG_07535

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.879

Rank 1 · TkA08G154160 · TK1151

Cytoplasm0.070

Rank 2 · TkA08G154160 · TK1151

Nucleus0.054

Rank 3 · TkA08G154160 · TK1151

Plastid0.030

Rank 4 · TkA08G154160 · TK1151

Cell membrane0.027

Rank 5 · TkA08G154160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr6-63 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G154160	`PF00153`	Mito_carr	6	63	1.4e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LB08`	Arabidopsis thaliana	sp\|Q8LB08\|ADT4_ARATH ADP/ATP translocase ER-ANT1	69.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card