TkA08G153910 | RubberDandelionOmics

Gene overview

TkA08G153910

Reference: TK1151 Chr: Chr08 Coordinates: 40167984-40170366 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1480 bp · TkA08G153910|TK1151|cDNA

CTTTTAGTTCATTATTCATCCATAGTTACTAAGCTTCGTCTAATAACTTATCGAGCTCCCCATTTGCTGCCTCTGAATTTGAAACTTTGAGGAGTTTCCTGATTAGTTTATTTAATCTGCAAGAAGACGTGCAGACTGCATAATGGATTGGTTTGGCACCCATGAATTTTCAGGCAGACAATATACCGGGAGATATGGAGGGAGTACAACATCAATGCGACCATTTCCTTCTATATCAGTTGCAGACGAAGGAAGAGGAA...

CDS

Download CDS FASTA

1152 bp · TkA08G153910|TK1151|CDS

ATGGATTGGTTTGGCACCCATGAATTTTCAGGCAGACAATATACCGGGAGATATGGAGGGAGTACAACATCAATGCGACCATTTCCTTCTATATCAGTTGCAGACGAAGGAAGAGGAAAGCATTTAATCAATCATGATTACCAATTGAAAGAAGACGAGCATCTTGCAATGGCTCTACAGGAAAGTTTGAAACTCGAACCTCCACCCTGGAACAGAACTGGAAACGGAAATACTTATCGACCTACACAATTCCCACAATC...

Protein

Download Protein FASTA

383 aa · TkA08G153910|TK1151|PROTEIN

MDWFGTHEFSGRQYTGRYGGSTTSMRPFPSISVADEGRGKHLINHDYQLKEDEHLAMALQESLKLEPPPWNRTGNGNTYRPTQFPQSTGFKENHHPRCNVCNNFIQTNAAGFAVYKAHPFWGQKYCVFHESDGTPRCCSCERMESKDTRYVALSDGRKLCLECLDSAIMDTTACQPLYVDIKKFYEGLGMKLEQNIPLLLVERQALNDAMDGETNGHYHMRETRGLCLSEEQTITTVLRQPRIGVGNWAPHMSTEPYKLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G153910`
TK1151 ID	TkA08G153910
OH-1004 ID	LXL04_021897
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.700
Protein coverage (%)	TK1151 76.501 / OH-1004 59.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G153910

Location Chr08:40167984-40170366 (-)

Description Similar to DAR2: Protein DA1-related 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36860`	Acts redundantly with DA1 and DAR2 to regulate endoreduplication during leaf development.	The ubiquitin receptors DA1, DAR1, and DAR2 redundantly regulate endoreduplication by modulating the stability of TCP14/15 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.132274
`At1g19270`	Ubiquitin receptor that limits final seed and organ size by restricting the period of cell proliferation.	No verified direct reference in this release
`At2g39830`	Acts redundantly with DA1 and DAR1 to regulate endoreduplication during leaf development.	Arabidopsis Lateral Root Development 3 is essential for early phloem development and function, and hence for normal root system development.2011 · DOI: 10.1111/j.1365-313x.2011.04700.x Control of root meristem size by DA1-RELATED PROTEIN2 in Arabidopsis.2013 · DOI: 10.1104/pp.112.210237 The ubiquitin receptors DA1, DAR1, and DAR2 redundantly regulate endoreduplication by modulating the stability of TCP14/15 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.132274
`At5g66610`	Ubiquitin receptor that probably regulates developmental process.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0267800`	Ubiquitin receptor that functions as a positive regulator of grain size and weight.	The ubiquitin-interacting motif-type ubiquitin receptor HDR3 interacts with and stabilizes the histone acetyltransferase GW6a to control the grain size in rice.2021 · DOI: 10.1093/plcell/koab194

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021897 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010088 phloem development Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:0046620 regulation of organ growth Biological Process

GO:0046621 negative regulation of organ growth Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0048482 plant ovule morphogenesis Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G19270

ath:AT2G39830

ath:AT4G36860

ath:AT5G66620

dosa:Os03g0267800

osa:4332368

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.652

Rank 1 · TkA08G153910 · TK1151

Cytoplasm0.326

Rank 2 · TkA08G153910 · TK1151

Cell membrane0.072

Rank 3 · TkA08G153910 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA08G153910 · TK1151

Plastid0.035

Rank 5 · TkA08G153910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12315DA1-like188-377 aa

PF14891Peptidase_M91281-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G153910	`PF12315`	DA1-like	188	377	1.1e-79	267.5
TkA08G153910	`PF14891`	Peptidase_M91	281	296	0.16	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4F0`	Arabidopsis thaliana	sp\|Q8W4F0\|DAR1_ARATH Protein DA1-related 1	66.000%	Swiss-Prot	High
`P0C7Q8`	Arabidopsis thaliana	sp\|P0C7Q8\|DA1_ARATH Protein DA1	63.400%	Swiss-Prot	High
`Q0WSN2`	Arabidopsis thaliana	sp\|Q0WSN2\|DAR2_ARATH Protein DA1-related 2	56.500%	Swiss-Prot	High
`Q9FJX9`	Arabidopsis thaliana	sp\|Q9FJX9\|DAR7_ARATH Protein DA1-related 7	48.000%	Swiss-Prot	Medium
`Q10NJ6`	Oryza sativa subsp. japonica	sp\|Q10NJ6\|HDR3_ORYSJ LIM domain-containing protein HDR3	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card