TkA08G151550 | RubberDandelionOmics

Gene overview

TkA08G151550

Reference: TK1151 Chr: Chr08 Coordinates: 39518641-39520773 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1970 bp · TkA08G151550|TK1151|cDNA

CGATCCCTGATTCTGCCAGTTGACTATTTATGTTCTAATTATCAACATCGTTGCTTCTTTCTTTCAACTTACATTCAGACTAAACTCCATAAAATGACCCCAAAATCATCGGTAGGGGTATCATGTCCTAAAGAAGAAGAAGAAAAATGGGGTGTTCACAGTCAACGATGGAGAGCAAAGAAGCTGTTAACCAATGCAAAGAAAGAAAAGCGTTTATCAAACAATCAATCTCCGGTTACCACGCCTTTGCCGCCGCCCAC...

CDS

Download CDS FASTA

1824 bp · TkA08G151550|TK1151|CDS

ATGGGGTGTTCACAGTCAACGATGGAGAGCAAAGAAGCTGTTAACCAATGCAAAGAAAGAAAAGCGTTTATCAAACAATCAATCTCCGGTTACCACGCCTTTGCCGCCGCCCACTTCGCCTACGCCGCGGCCCTGAAAAACGCCGGTGCCGCCCTCAGTGATTACGCCCAAGGGGAGCTCCAATTTCCCGACCATCTCCGTTACGATTCCCTACCCCCATTACCACACTCCGATTCCCGGGGATTTAAAGATCATTCAAA...

Protein

Download Protein FASTA

608 aa · TkA08G151550|TK1151|PROTEIN

MGCSQSTMESKEAVNQCKERKAFIKQSISGYHAFAAAHFAYAAALKNAGAALSDYAQGELQFPDHLRYDSLPPLPHSDSRGFKDHSNTIRGIVNEVPNHGSEHRSNDKSSVSGDSNREIGKDNGIVPWDFFFTSMEGVVFAQVDDKSSRIGKSEIQRTTADCNSGRHRAVVESEREPPLASMKEDVQSMKLLRVIKELDDGFVKASGIAHEVSNILEASMLHCDSNSTDNSSWKHLFKGHQIGNDEEENYAPKEEQTHYM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G151550`
TK1151 ID	TkA08G151550
OH-1004 ID	LXL04_032123
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 98.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G151550

Location Chr08:39518641-39520773 (-)

Description Similar to REL2: Protein ROLLING AND ERECT LEAF 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60320`	Required for nitrate signaling.	The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.2016 · DOI: 10.1105/tpc.15.00567

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0562700`	Involved in the regulation of leaf shape formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032123 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0030154 cell differentiation Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51290

ath:AT3G60320

dosa:Os10g0562700

osa:4349394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkA08G151550 · TK1151

Cell membrane0.377

Rank 2 · TkA08G151550 · TK1151

Nucleus0.283

Rank 3 · TkA08G151550 · TK1151

Golgi apparatus0.046

Rank 4 · TkA08G151550 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA08G151550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04783DUF6301-59 aa

PF27150Rv2240c5-59 aa

PF04782DUF632191-483 aa

PF15460SAS4230-261 aa

PF30117MSD5270-347 aa

PF27695CEP131_C333-390 aa

PF30117MSD5367-395 aa

PF15466DUF4635414-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G151550	`PF04783`	DUF630	1	59	3.4e-21	75.9
TkA08G151550	`PF27150`	Rv2240c	5	59	0.12	13.7
TkA08G151550	`PF04782`	DUF632	191	483	2e-76	258.0
TkA08G151550	`PF15460`	SAS4	230	261	0.11	13.2
TkA08G151550	`PF30117`	MSD5	270	347	0.26	12.3
TkA08G151550	`PF27695`	CEP131_C	333	390	0.37	10.5
TkA08G151550	`PF30117`	MSD5	367	395	0.26	12.3
TkA08G151550	`PF15466`	DUF4635	414	436	0.067	13.4
TkA08G151550	`PF27150`	Rv2240c	448	468	0.12	13.7
TkA08G151550	`PF15460`	SAS4	484	520	0.11	13.2
TkA08G151550	`PF27150`	Rv2240c	494	532	0.12	13.7
TkA08G151550	`PF15466`	DUF4635	495	526	0.067	13.4
TkA08G151550	`PF27695`	CEP131_C	532	575	0.37	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YU8`	Arabidopsis thaliana	sp\|Q93YU8\|NRG2_ARATH Nitrate regulatory gene2 protein	26.100%	Swiss-Prot	Low
`Q9AQW1`	Oryza sativa subsp. japonica	sp\|Q9AQW1\|REL2_ORYSJ Protein ROLLING AND ERECT LEAF 2	27.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card