TkA08G149760 | RubberDandelionOmics

Gene overview

TkA08G149760

Reference: TK1151 Chr: Chr08 Coordinates: 38972453-38974832 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1183 bp · TkA08G149760|TK1151|cDNA

GATGCATGGGTAAAAGAGTGTAATTATGTTGTTATTATCGACGATAAAATAAATTACATTATATATATTGGCAACAAGAAGAAAGCAAGTTGCAATTTTCCTTAATTTTATAACTTGGTTCTTTTTGTGCAGGGACCTGTTGATGTGTTACACTGAATTCCAGCCAAAGATATAGCCAAGAGGTACAATTTCTAAATATATCGAATACTACAATTTAAAGAAAGGGATCACTTATTGCCAGTACAAGGATTCTGAAAGGA...

CDS

Download CDS FASTA

696 bp · TkA08G149760|TK1151|CDS

ATGTGTGTACTACAGGATTTTGAGGCCTTGACACCAAACCTTCTAGCAAGAACCATAGAAACAGTAGAAGGTGGTGGATTGATAATTCTAATGCTTCGTTCTTTGTCTTCTCTCACTAGTCTCTACACCATGGTCATGGATGTTCATGAAATATTCCGTACAGAATCTCACTCTTTAGCAACTGGACGTTTCAATGAACGTTTTCTACTTTCTCTAGCATCATGTGGATCATGTATAGTCATGGATGATGAGTTAAACAT...

Protein

Download Protein FASTA

231 aa · TkA08G149760|TK1151|PROTEIN

MCVLQDFEALTPNLLARTIETVEGGGLIILMLRSLSSLTSLYTMVMDVHEIFRTESHSLATGRFNERFLLSLASCGSCIVMDDELNILPISSHMRSVTPVTAEEDSDGLSEAERDLKHLKEQLKDEFPVGPLIKKCCTLDQGKVVITFLDAILDKTLRSTVALLAGRGRGKSAALGLAIAGAVAAGLAYSMRKMMSDKALVPDNLSMVPNNSPLGNRRSSSESHYNNETSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G149760`
TK1151 ID	TkA08G149760
OH-1004 ID	LXL04_013526
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 80.519 / OH-1004 17.782 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G149760

Location Chr08:38972453-38974832 (+)

Description Similar to At1g10490: RNA cytidine acetyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57940`	RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs.	No verified direct reference in this release
`At1g10490`	RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000154 rRNA modification Biological Process

GO:0002101 tRNA wobble cytosine modification Biological Process

GO:0006417 regulation of translation Biological Process

GO:0006473 protein acetylation Biological Process

GO:0010824 regulation of centrosome duplication Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0045727 positive regulation of translation Biological Process

GO:0051391 tRNA acetylation Biological Process

GO:1904812 rRNA acetylation involved in maturation of SSU-rRNA Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT1G10490

ath:AT3G57940

ddi:DDB_G0268868

hsa:55226

mmu:98956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.446

Rank 1 · TkA08G149760 · TK1151

Cytoplasm0.339

Rank 2 · TkA08G149760 · TK1151

Mitochondrion0.114

Rank 3 · TkA08G149760 · TK1151

Endoplasmic reticulum0.095

Rank 4 · TkA08G149760 · TK1151

Cell membrane0.067

Rank 5 · TkA08G149760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08351TmcA_N6-81 aa

PF05127NAT10_TcmA_helicase163-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G149760	`PF08351`	TmcA_N	6	81	6.1e-08	33.0
TkA08G149760	`PF05127`	NAT10_TcmA_helicase	163	186	0.00033	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Q4`	Arabidopsis thaliana	sp\|Q9M2Q4\|NT102_ARATH RNA cytidine acetyltransferase 2	81.600%	Swiss-Prot	High
`Q9XIK4`	Arabidopsis thaliana	sp\|Q9XIK4\|NT101_ARATH RNA cytidine acetyltransferase 1	79.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card