TkA08G144880 | RubberDandelionOmics

Gene overview

TkA08G144880

Reference: TK1151 Chr: Chr08 Coordinates: 37795722-37798288 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

822 bp · TkA08G144880|TK1151|cDNA

ATGATATCTTCGGAACCCGTCAAAGGTTTAGTAAAGTTACCTCTCGCCATCGCTTCCAACATACCAATTAACCTGGTGGCTTACGAGGTATGCAACGCATCTGGACCGTTGATTTTGACTCGTTATATTGAGTTGATGAATGGGATTATTGATACCAAGGAAGATGCAAGGTTGCTTAGAGAAATGGGGATCATCAAGAACAGACTGAAAACCGATGAAGAGATTGCTAATTTGTTGAATGGGATGAGCAGGCGTACCCT...

CDS

Download CDS FASTA

822 bp · TkA08G144880|TK1151|CDS

ATGATATCTTCGGAACCCGTCAAAGGTTTAGTAAAGTTACCTCTCGCCATCGCTTCCAACATACCAATTAACCTGGTGGCTTACGAGGTATGCAACGCATCTGGACCGTTGATTTTGACTCGTTATATTGAGTTGATGAATGGGATTATTGATACCAAGGAAGATGCAAGGTTGCTTAGAGAAATGGGGATCATCAAGAACAGACTGAAAACCGATGAAGAGATTGCTAATTTGTTGAATGGGATGAGCAGGCGTACCCT...

Protein

Download Protein FASTA

273 aa · TkA08G144880|TK1151|PROTEIN

MISSEPVKGLVKLPLAIASNIPINLVAYEVCNASGPLILTRYIELMNGIIDTKEDARLLREMGIIKNRLKTDEEIANLLNGMSRRTLVNSLEEMMDIVKEEAESSTRKTCRQIVRDRIAASDCVMTHYFNDDAVYGPAIFRRRFRMHKPIFLRIVNDIENVSSFIRQGCDARAEGFTLIQKCAAAIRHLEEFCECIIFLYKKRYLRKPYITDVPQLYAHHAEVHGFPGMLGSLDCMHWDWGNCPVRYQEQYTRGGKRHPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G144880`
TK1151 ID	TkA08G144880
OH-1004 ID	LXL04_032048
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 52.456 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G144880

Location Chr08:37795722-37798288 (-)

Description Similar to At3g02645: Putative UPF0481 protein At3g02645

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02645`	Putative UPF0481 protein At3g02645.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032048 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G02645

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.257

Rank 1 · TkA08G144880 · TK1151

Extracellular0.208

Rank 2 · TkA08G144880 · TK1151

Endoplasmic reticulum0.191

Rank 3 · TkA08G144880 · TK1151

Nucleus0.147

Rank 4 · TkA08G144880 · TK1151

Cell membrane0.104

Rank 5 · TkA08G144880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03140DUF24723-115 aa

PF28509DUF8418125-159 aa

PF04827Plant_tran203-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G144880	`PF03140`	DUF247	23	115	2.2e-21	77.4
TkA08G144880	`PF28509`	DUF8418	125	159	4.4e-15	55.8
TkA08G144880	`PF04827`	Plant_tran	203	273	3.1e-24	86.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C897`	Arabidopsis thaliana	sp\|P0C897\|Y3264_ARATH Putative UPF0481 protein At3g02645	63.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card