TkA08G144730 | RubberDandelionOmics

Gene overview

TkA08G144730

Reference: TK1151 Chr: Chr08 Coordinates: 37767251-37772885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4283 bp · TkA08G144730|TK1151|cDNA

TAAGAAGTAAAAGTGAAGAACGATTAACCAAACAATTTCATAGTGTAGTCTAATAGCGATTTAGCGAGCCATCTTACGGTGATCGGAACACTTCATTTGGGCTGAATGCAAGCTATGGAAACAGATGTAGTCCATCCTCCGCCGAGGATCCAGCGCCTTGACGAGTCTGTCGTCAACCGAATTGCGGCCGGTGAGGTCATTCAACGCCCCGTTGCCGCCGTCAAGGAGCTCGTCGAGAACAGCCTTGATGCCGGCTCCAC...

CDS

Download CDS FASTA

2157 bp · TkA08G144730|TK1151|CDS

ATGCAAGCTATGGAAACAGATGTAGTCCATCCTCCGCCGAGGATCCAGCGCCTTGACGAGTCTGTCGTCAACCGAATTGCGGCCGGTGAGGTCATTCAACGCCCCGTTGCCGCCGTCAAGGAGCTCGTCGAGAACAGCCTTGATGCCGGCTCCACCTCCATACATGTTACTGTTAAGGACGGAGGCCTTAAACTCATTCAAGTTTCAGACGATGGCCATGGAATCCGGTATGATGACTTGCCGATTCTATGTGAGAGGCA...

Protein

Download Protein FASTA

718 aa · TkA08G144730|TK1151|PROTEIN

MQAMETDVVHPPPRIQRLDESVVNRIAAGEVIQRPVAAVKELVENSLDAGSTSIHVTVKDGGLKLIQVSDDGHGIRYDDLPILCERHTTSKLSAFEDLQSIKSMGFRGEALASMTYVAHVTVTTITGGQLHGYRVSYRDGVMEHEPKACAAVKGTQITIENLFYNMIARRKTLQNSADDYPKIVDLLSRFAIHHKNVSFSCRKHGAGTADLHSVAMSTRLDAIRSVYGVSIARSLMKIEASDSNPSTSVFEMDGFISDSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G144730`
TK1151 ID	TkA08G144730
OH-1004 ID	LXL04_032046
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G144730

Location Chr08:37767251-37772885 (-)

Description Similar to MLH1: DNA mismatch repair protein MLH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09140`	Involved in DNA mismatch repair (MMR), correcting insertion- deletion loops (IDLs) resulting from DNA replication, DNA damage or from recombination events between non-identical sequences during meiosis.	Control of meiotic recombination in Arabidopsis: role of the MutL and MutS homologues.2006 · DOI: 10.1042/bst0340542 An Arabidopsis MLH1 mutant exhibits reproductive defects and reveals a dual role for this gene in mitotic recombination.2007 · DOI: 10.1111/j.1365-313x.2007.03145.x Yeast mutator phenotype enforced by Arabidopsis PMS1 expression.2013 · DOI: 10.1007/s11033-012-2269-5

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032046 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:0000710 meiotic mismatch repair Biological Process

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006281 DNA repair Biological Process

GO:0006298 mismatch repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007060 male meiosis chromosome segregation Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

KEGG gene cross-reference

ath:AT4G09140

hsa:4292

mmu:17350

rno:81685

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.937

Rank 1 · TkA08G144730 · TK1151

Cytoplasm0.144

Rank 2 · TkA08G144730 · TK1151

Mitochondrion0.025

Rank 3 · TkA08G144730 · TK1151

Cell membrane0.018

Rank 4 · TkA08G144730 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA08G144730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518HATPase_c34-97 aa

PF13589HATPase_c_337-139 aa

PF02518HATPase_c195-237 aa

PF01119DNA_mis_repair223-343 aa

PF16413Mlh1_C439-718 aa

PF13589HATPase_c_3533-554 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G144730	`PF02518`	HATPase_c	34	97	1e-07	33.1
TkA08G144730	`PF13589`	HATPase_c_3	37	139	1e-13	52.2
TkA08G144730	`PF02518`	HATPase_c	195	237	1e-07	33.1
TkA08G144730	`PF01119`	DNA_mis_repair	223	343	1.6e-29	102.7
TkA08G144730	`PF16413`	Mlh1_C	439	718	2.6e-85	286.8
TkA08G144730	`PF13589`	HATPase_c_3	533	554	1e-13	52.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZRV4`	Arabidopsis thaliana	sp\|Q9ZRV4\|MLH1_ARATH DNA mismatch repair protein MLH1	72.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card