TkA08G144560 | RubberDandelionOmics

Gene overview

TkA08G144560

Reference: TK1151 Chr: Chr08 Coordinates: 37711265-37717877 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3774 bp · TkA08G144560|TK1151|cDNA

CTTTTCTCCTTTTCTTACTTTTTCGGGGGTTTTTTTTACAGATCTGTTTAGTTAGAAGTTAGAACCCTAATTTTCAATCTCGCCGATTTGGGGGTCGGCGGAGCTGCAATGTCGTCTCTAAGTAGAGAGCTCGTGTTCTTGATCTTACAGTTTCTCGATGAAGAAAAGTTTAAGGAGACTGTTCACAAGCTTGAACAAGAATCAGGTTTTTTCTTTAACATGAAGTACTTTGAAGATGAGGTACAGAATGGAAATTGGGA...

CDS

Download CDS FASTA

3426 bp · TkA08G144560|TK1151|CDS

ATGTCGTCTCTAAGTAGAGAGCTCGTGTTCTTGATCTTACAGTTTCTCGATGAAGAAAAGTTTAAGGAGACTGTTCACAAGCTTGAACAAGAATCAGGTTTTTTCTTTAACATGAAGTACTTTGAAGATGAGGTACAGAATGGAAATTGGGATGACGTTGAGAAATACCTTTCGGGTTTTACAAAAGTGGACGATAATCGTTACTCAATGAAGATATTTTTTGAAATCAGGAAGCAAAAGTATCTTGAAGCATTGGACAA...

Protein

Download Protein FASTA

1141 aa · TkA08G144560|TK1151|PROTEIN

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVQNGNWDDVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRSKAVEILVKDLKVFASFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPNLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGQPNGARAPSPANNPLLGPLPKAGGFPPLGAHGPFQPTPGPVPTPLAGWMSNPPAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G144560`
TK1151 ID	TkA08G144560
OH-1004 ID	LXL04_002707
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.100
Protein coverage (%)	TK1151 98.160 / OH-1004 63.028 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G144560

Location Chr08:37711265-37717877 (-)

Description Similar to TPR4: Topless-related protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15750`	Transcriptional corepressor.	No verified direct reference in this release
`At1g80490`	Transcriptional corepressor.	Arabidopsis resistance protein SNC1 activates immune responses through association with a transcriptional corepressor.2010 · DOI: 10.1073/pnas.1002828107
`At3g15880`	Transcription corepressor of Zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0254700`	Probable downstream regulator of strigolactones signaling (By similarity).	MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171
`Os08g0162100`	Transcriptional corepressor involved in branch formation regulation, presumably by suppressing primary branch formation and promoting secondary branch formation.	OsLIS-L1 encoding a lissencephaly type-1-like protein with WD40 repeats is required for plant height and male gametophyte formation in rice.2012 · DOI: 10.1007/s00425-011-1532-7

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010072 primary shoot apical meristem specification Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G15750

ath:AT1G80490

ath:AT3G15880

dosa:Os03g0254700

dosa:Os08g0162100

osa:4332285

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.609

Rank 1 · TkA08G144560 · TK1151

Cytoplasm0.330

Rank 2 · TkA08G144560 · TK1151

Lysosome / Vacuole0.072

Rank 3 · TkA08G144560 · TK1151

Cell membrane0.071

Rank 4 · TkA08G144560 · TK1151

Golgi apparatus0.045

Rank 5 · TkA08G144560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25437BRWD1_N3-31 aa

PF17814LisH_TPL5-34 aa

PF23627LisH_WDR267-34 aa

PF21889TPR1-like_2nd37-161 aa

PF10607CTLH69-135 aa

PF21359zf_topless164-204 aa

PF30552CFAP251_N344-385 aa

PF23414Beta-prop_EML_2348-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G144560	`PF25437`	BRWD1_N	3	31	0.052	14.5
TkA08G144560	`PF17814`	LisH_TPL	5	34	4.1e-13	49.4
TkA08G144560	`PF23627`	LisH_WDR26	7	34	0.3	11.2
TkA08G144560	`PF21889`	TPR1-like_2nd	37	161	2.1e-63	212.9
TkA08G144560	`PF10607`	CTLH	69	135	0.012	16.4
TkA08G144560	`PF21359`	zf_topless	164	204	6.1e-25	87.3
TkA08G144560	`PF30552`	CFAP251_N	344	385	1.2e-07	32.0
TkA08G144560	`PF23414`	Beta-prop_EML_2	348	473	9e-34	117.8
TkA08G144560	`PF25171`	Beta-prop_WDR36-Utp21_1st	350	387	6.1e-17	62.6
TkA08G144560	`PF23383`	Beta-prop_IFT140_1st	350	385	2.2e-11	43.9
TkA08G144560	`PF25174`	Beta-prop_THOC3	351	384	3.9e-42	144.8
TkA08G144560	`PF24807`	WD40_CDC20-Fz	352	390	1.3e-29	104.2
TkA08G144560	`PF24814`	WD40_Prp19	353	388	4.7e-39	134.9
TkA08G144560	`PF23381`	Beta-prop_IFT122_1st	355	384	3.6e-37	128.9
TkA08G144560	`PF24796`	WDR55	355	386	1.5e-23	84.0
TkA08G144560	`PF23393`	Beta-prop_WDR90_POC16_2nd	355	387	3.8e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AI7`	Arabidopsis thaliana	sp\|Q94AI7\|TPL_ARATH Protein TOPLESS	82.500%	Swiss-Prot	High
`Q0WV90`	Arabidopsis thaliana	sp\|Q0WV90\|TPR1_ARATH Topless-related protein 1	81.100%	Swiss-Prot	High
`Q27GK7`	Arabidopsis thaliana	sp\|Q27GK7\|TPR4_ARATH Topless-related protein 4	68.800%	Swiss-Prot	High
`Q10NY2`	Oryza sativa subsp. japonica	sp\|Q10NY2\|TPR3_ORYSJ Protein TPR3	80.600%	Swiss-Prot	High
`Q0J7U6`	Oryza sativa subsp. japonica	sp\|Q0J7U6\|TPR2_ORYSJ Protein TOPLESS-RELATED PROTEIN 2	67.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card