TkA08G143090 | RubberDandelionOmics

Gene overview

TkA08G143090

Reference: TK1151 Chr: Chr08 Coordinates: 37281378-37281983 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

606 bp · TkA08G143090|TK1151|cDNA

ATGAACAATCAGTTTTTCTACAACTCCTTCACCAAACCTCAGTTTCTAGACAACTACTCGAGTTTCGACCAAAATCCTGAAAATTACCCATTTCCGGAAACCAAGATTTCGTCGGAATTCAACGCCGTAGAAAACCCTGTTATTCTGGAAGGCATCGCCGCCGTAGTCGGCGAGCATGTTCTGTTCGGAAAGAGTACCATTACATCCCGTGATCAAAACGAAGGATCAAAGCTCCAACCGGTGAAGAATGGCGGTGGCGC...

CDS

Download CDS FASTA

606 bp · TkA08G143090|TK1151|CDS

ATGAACAATCAGTTTTTCTACAACTCCTTCACCAAACCTCAGTTTCTAGACAACTACTCGAGTTTCGACCAAAATCCTGAAAATTACCCATTTCCGGAAACCAAGATTTCGTCGGAATTCAACGCCGTAGAAAACCCTGTTATTCTGGAAGGCATCGCCGCCGTAGTCGGCGAGCATGTTCTGTTCGGAAAGAGTACCATTACATCCCGTGATCAAAACGAAGGATCAAAGCTCCAACCGGTGAAGAATGGCGGTGGCGC...

Protein

Download Protein FASTA

201 aa · TkA08G143090|TK1151|PROTEIN

MNNQFFYNSFTKPQFLDNYSSFDQNPENYPFPETKISSEFNAVENPVILEGIAAVVGEHVLFGKSTITSRDQNEGSKLQPVKNGGGAVKSYRGVRKRPWGRWAAEIRDRIGRCRHWLGTFDTAEEAARAYDAAARRMRGANARTNFEIPSVFPLPTSSPVSSSSSSVEGKKRKSGNTCGTNKCHVVTSMAQLFSNTDWKMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G143090`
TK1151 ID	TkA08G143090
OH-1004 ID	LXL04_032034
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G143090

Location Chr08:37281378-37281983 (-)

Description Similar to ERF084: Ethylene-responsive transcription factor ERF084

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80580`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g14230`	Transcription factor involved in carotenoid biosynthesis regulation.	Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.2010 · DOI: 10.1104/pp.110.155077
`At5g53290`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032034 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G12980

ath:AT1G24590

ath:AT1G80580

ath:AT3G15210

nsy:104222902

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA08G143090 · TK1151

Cytoplasm0.083

Rank 2 · TkA08G143090 · TK1151

Cell membrane0.023

Rank 3 · TkA08G143090 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G143090 · TK1151

Plastid0.016

Rank 5 · TkA08G143090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP290-139 aa

PF25947WHD_halo_double95-135 aa

PF00847AP2168-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G143090	`PF00847`	AP2	90	139	2e-15	57.5
TkA08G143090	`PF25947`	WHD_halo_double	95	135	0.058	14.0
TkA08G143090	`PF00847`	AP2	168	175	2e-15	57.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8M5`	Arabidopsis thaliana	sp\|Q9M8M5\|ERF84_ARATH Ethylene-responsive transcription factor ERF084	46.500%	Swiss-Prot	Medium
`Q9LUM4`	Arabidopsis thaliana	sp\|Q9LUM4\|RAP22_ARATH Ethylene-responsive transcription factor RAP2-2	58.800%	Swiss-Prot	Low
`Q9FK12`	Arabidopsis thaliana	sp\|Q9FK12\|CRF3_ARATH Ethylene-responsive transcription factor CRF3	41.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card