TkA08G141850 | RubberDandelionOmics

Gene overview

TkA08G141850

Reference: TK1151 Chr: Chr08 Coordinates: 36952025-36953638 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · TkA08G141850|TK1151|cDNA

ATGCTTGATTCGGAGTCGTTAGACGCCGAACAATTGAAGACCGAGCCGGAATTCGGTGTTGATTTGTTCAGTCAGGATCTATCTGGAACTTTAGCTGGCGGCGGCGTGGGAGACTCTCCGGCGATTGGAACTCCCCTCGATAGTAGTACCGCAAATGAGGTAGATTTCGCTCTTGCTCTACAAGCGTCTTCGTCTTCGACGCCGGTCAATAATAAGGTTGCGTCTCCTAATCTAAAATTAAGGTTCACAAACGAAAAAGG...

CDS

Download CDS FASTA

1260 bp · TkA08G141850|TK1151|CDS

ATGCTTGATTCGGAGTCGTTAGACGCCGAACAATTGAAGACCGAGCCGGAATTCGGTGTTGATTTGTTCAGTCAGGATCTATCTGGAACTTTAGCTGGCGGCGGCGTGGGAGACTCTCCGGCGATTGGAACTCCCCTCGATAGTAGTACCGCAAATGAGGTAGATTTCGCTCTTGCTCTACAAGCGTCTTCGTCTTCGACGCCGGTCAATAATAAGGTTGCGTCTCCTAATCTAAAATTAAGGTTCACAAACGAAAAAGG...

Protein

Download Protein FASTA

419 aa · TkA08G141850|TK1151|PROTEIN

MLDSESLDAEQLKTEPEFGVDLFSQDLSGTLAGGGVGDSPAIGTPLDSSTANEVDFALALQASSSSTPVNNKVASPNLKLRFTNEKGKELSIDNKFTNYDDDLGLNFDNNHIREPTMTPSDDRKTGKKQWGKDWWWKQDGSGELCSKDYVREWIGSQMCPSVNPDWDDDKNFESKDSNENKPENEEQTSWKRHRKMQEWWKEEHLDELTKKKVDKKKIKRKFKLSIFRKKRKQNHRNNENGIDPNTEFSFRKNSKKNSED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G141850`
TK1151 ID	TkA08G141850
OH-1004 ID	LXL04_032013
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.700
Protein coverage (%)	TK1151 97.613 / OH-1004 65.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G141850

Location Chr08:36952025-36953638 (-)

Description Similar to At1g80870: Putative receptor-like protein kinase At1g80870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80870`	Putative receptor-like protein kinase At1g80870.	No verified direct reference in this release
`At2g45590`	Receptor-like serine/threonine-protein kinase At2g45590.	No verified direct reference in this release
`At4g25390`	Receptor-like serine/threonine-protein kinase At4g25390.	No verified direct reference in this release
`At1g29720`	Probable LRR receptor-like serine/threonine-protein kinase At1g29720.	No verified direct reference in this release
`At5g03140`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032013 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G80870

ath:AT2G45590

ath:AT4G25390

ath:AT5G15730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.372

Rank 1 · TkA08G141850 · TK1151

Nucleus0.364

Rank 2 · TkA08G141850 · TK1151

Cytoplasm0.329

Rank 3 · TkA08G141850 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA08G141850 · TK1151

Golgi apparatus0.043

Rank 5 · TkA08G141850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31042DUF8782124-234 aa

PF00069Pkinase267-382 aa

PF07714PK_Tyr_Ser-Thr267-384 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G141850	`PF31042`	DUF8782	124	234	0.93	10.2
TkA08G141850	`PF00069`	Pkinase	267	382	2e-07	31.4
TkA08G141850	`PF07714`	PK_Tyr_Ser-Thr	267	384	8.6e-05	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAH3`	Arabidopsis thaliana	sp\|Q9SAH3\|Y1887_ARATH Putative receptor-like protein kinase At1g80870	47.600%	Swiss-Prot	Medium
`O64639`	Arabidopsis thaliana	sp\|O64639\|Y2559_ARATH Receptor-like serine/threonine-protein kinase At2g45590	57.700%	Swiss-Prot	Low
`Q9STJ8`	Arabidopsis thaliana	sp\|Q9STJ8\|Y4539_ARATH Receptor-like serine/threonine-protein kinase At4g25390	48.100%	Swiss-Prot	Low
`Q9ASQ6`	Arabidopsis thaliana	sp\|Q9ASQ6\|Y1972_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g29720	39.800%	Swiss-Prot	Low
`Q9LYX1`	Arabidopsis thaliana	sp\|Q9LYX1\|LRK82_ARATH L-type lectin-domain containing receptor kinase VIII.2	38.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card