RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G135280
Reference: TK1151 Chr: Chr08 Coordinates: 35191839-35192291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

312 bp · TkA08G135280|TK1151|cDNA

ATGGAAGCTCGAATTGGGGTATTGCTCGGAGTTTTGGTGATCGGAAAACTTCCATCTGATGAGTTTTTCCAGAACACGTCGGAAGTGAGTTTGGTGAAATGGATGAGGAAGGTGATGACTTCTGATAATCCGAAAGAGGCGATTGATCCAAGCCTTTTGGAAAATGGATATGAGGAACAAATGCTTCTTGTTCTTAAGATTGCTTGTTTTTGTACTTTGGATAATCCCAAAGAGAGGCCTAATAGCAAGGATTGTAGGGT...

CDS

Download CDS FASTA

312 bp · TkA08G135280|TK1151|CDS

ATGGAAGCTCGAATTGGGGTATTGCTCGGAGTTTTGGTGATCGGAAAACTTCCATCTGATGAGTTTTTCCAGAACACGTCGGAAGTGAGTTTGGTGAAATGGATGAGGAAGGTGATGACTTCTGATAATCCGAAAGAGGCGATTGATCCAAGCCTTTTGGAAAATGGATATGAGGAACAAATGCTTCTTGTTCTTAAGATTGCTTGTTTTTGTACTTTGGATAATCCCAAAGAGAGGCCTAATAGCAAGGATTGTAGGGT...

Protein

Download Protein FASTA

103 aa · TkA08G135280|TK1151|PROTEIN

MEARIGVLLGVLVIGKLPSDEFFQNTSEVSLVKWMRKVMTSDNPKEAIDPSLLENGYEEQMLLVLKIACFCTLDNPKERPNSKDCRVMLAQVDSLNLVSPNVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G135280
TK1151 IDTkA08G135280
OH-1004 IDLXL04_001342
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)78.200
Protein coverage (%)TK1151 84.466 / OH-1004 12.794
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G135280
LocationChr08:35191839-35192291 (+)
DescriptionSimilar to SOBIR1: Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g31880 Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.
Regulation of cell death and innate immunity by two receptor-like kinases in Arabidopsis.2009 · DOI: 10.1016/j.chom.2009.05.019
An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001342 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0030308 negative regulation of cell growth Biological Process
KEGG gene cross-reference
ath:AT2G31880
ath:AT3G51550
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.350
Rank 1 · TkA08G135280 · TK1151
Cell membrane0.331
Rank 2 · TkA08G135280 · TK1151
Endoplasmic reticulum0.169
Rank 3 · TkA08G135280 · TK1151
Nucleus0.159
Rank 4 · TkA08G135280 · TK1151
Golgi apparatus0.072
Rank 5 · TkA08G135280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SKB2Arabidopsis thalianasp|Q9SKB2|SBIR1_ARATH Leucine-rich repeat receptor-like serine/threonine/tyrosine-protein kinase SOBIR171.300%Swiss-ProtHigh

JBrowse

View in Genome Browser