Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3086 bp · TkA08G122000|TK1151|cDNA
CAAGGAAACATCGAACGGACAGTTATGTCCCTATCCCCCACCCCCACAAAACACATAACTCGAACCTCCATCAACTACATATGCTCCCCATCATACAATTCATCGACATTTCCAGAAAAACTAAAATCCAATAAGAACCCGAATCGCAAAATAACGGTGCCTCTTTCAGCCCCTTCTTTGCCCATTTGCATTTTCTCAAAAAACAGGGGAGGTTGGGGGTCTAAATTCCTTACGATACATTTGAATCCTTTCATAAACTG...
1791 bp · TkA08G122000|TK1151|CDS
ATGTATTTGAATCCAAGAGGGGAAGCTTATTTTCTCAGAAAAGAGATAATTTCAGACGAATCGCGTTCAGGTGAAGCAGATAAAGATCCCCGATGTCTTCGACAAGTAAAGTCAAAAAGTCTCGATTACAATTACGATCAGTGTACTTCACTTACTGATGTCAACAACACCCAGGCCTTTTCCAGAAATCTAGGGTTTGTTCTCGAAAGAAAAAACATGAAAAACGAGAACGGCGTCGGTAGGAAATCCGCCGACAGTGC...
Protein
Download Protein FASTA596 aa · TkA08G122000|TK1151|PROTEIN
MYLNPRGEAYFLRKEIISDESRSGEADKDPRCLRQVKSKSLDYNYDQCTSLTDVNNTQAFSRNLGFVLERKNMKNENGVGRKSADSAEIAADLLEMKWSTSLSTKNNKNAEEHNNKDDGEIIGGKLEASLVLHEEHFVNKSEQDNEKNPKLVEVDDVLVTKVDKDGIVEIYEGQGGNLENGILKEESNGSEVPLKLGAESCLTEVACIQQQNLSQDSQPCSVVAVSLSQVKDEVKSPFDSNSQMSISPNLGSDLSPGTFE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G122000 |
|---|---|
| TK1151 ID | TkA08G122000 |
| OH-1004 ID | LXL04_008162 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 46.700 |
| Protein coverage (%) | TK1151 98.993 / OH-1004 83.562Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G122000 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:31738771-31743018 (+) | |||||||||
| Description | Similar to PAH2: Phosphatidate phosphatase PAH2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006886 intracellular protein transport Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0009062 fatty acid catabolic process Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0019375 galactolipid biosynthetic process Biological Process GO:0019432 triglyceride biosynthetic process Biological Process GO:0032869 cellular response to insulin stimulus Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G09560 ath:AT5G42870 hsa:9663 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08235LNS2400-590 aaPF25109HAD_PNKP446-506 aaPF24694LNS2_PITM1-3448-588 aaPF09949APP1_cat448-561 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G122000 | PF08235 | LNS2 | 400 | 590 | 3.5e-82 | 275.9 |
| TkA08G122000 | PF25109 | HAD_PNKP | 446 | 506 | 0.0034 | 18.2 |
| TkA08G122000 | PF24694 | LNS2_PITM1-3 | 448 | 588 | 0.0036 | 18.0 |
| TkA08G122000 | PF09949 | APP1_cat | 448 | 561 | 0.021 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.