TkA08G112490 | RubberDandelionOmics

Gene overview

TkA08G112490

Reference: TK1151 Chr: Chr08 Coordinates: 29255013-29261397 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3231 bp · TkA08G112490|TK1151|cDNA

TTAAATTTCAAAACCCCGCGCTGTCTTTCCATCTCCAACAAAACACATACGCCTATAGCTATAGATATACATATACATGTATAGATTCATATACACACACATTAACACACCCAACGATAGTGAAAATGGAATTGCAGAACGGATTCAAGCTTTTGCTTCAACAATACAAAGCTTTGTTCACGAAGAACTTGCTGCTCGCATGGCGGAACAAGAGGGCTACATTCCTTCAGTTATTTTCATCAATATTCTTCATATTTTTA...

CDS

Download CDS FASTA

1524 bp · TkA08G112490|TK1151|CDS

ATGAGCTGTCCTGGAGCTCTCCACTTTGTAGAGAGAAATGCGACGGTAATTAGTTACGGCTTACAGACAAACTCTACTCCTATTGCAAAACGAGGACATTATGAAGATCCAACGTTCAAATTCTCAATCCCACTCCAAATTGCTGCTGAACGTGAAATTGCAAGGTCATTAATAGGAGATCCTGGTTTCAGTTGGGTTGTGAATCTGAAGGAATTTGCACATCCTGTAGTTGAAACATACTCTTCTGTGGCGATAGTAGG...

Protein

Download Protein FASTA

507 aa · TkA08G112490|TK1151|PROTEIN

MSCPGALHFVERNATVISYGLQTNSTPIAKRGHYEDPTFKFSIPLQIAAEREIARSLIGDPGFSWVVNLKEFAHPVVETYSSVAIVGPTFFLAIAMFGFVLQISSLITEKELKLRQAMAMMGLYDTAYWLSWLTWEGIISLLSSLFIVIFGIMFQFDTFLHNSFSVVFLVFFLFQLNMIGFAFMFSSFMSKSTSSTSVGFSVFIVGLLTQVVTIFGFPYSDNFSNTQRIIWSFFPPNLLAKALQLLADATATPEDPGISW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112490`
TK1151 ID	TkA08G112490
OH-1004 ID	LXL04_031363
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.600
Protein coverage (%)	TK1151 96.844 / OH-1004 51.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112490

Location Chr08:29255013-29261397 (-)

Description Similar to ABCA2: ABC transporter A family member 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47730`	ABC transporter A family member 2.	No verified direct reference in this release
`At5g61690`	ABC transporter A family member 11.	No verified direct reference in this release
`At5g61730`	Mediates the transport of acyl-CoAs and/or free fatty acids to the endoplasmic reticulum.	AtABCA9 transporter supplies fatty acids for lipid synthesis to the endoplasmic reticulum.2013 · DOI: 10.1073/pnas.1214159110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006641 triglyceride metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0010867 positive regulation of triglyceride biosynthetic process Biological Process

GO:0034197 triglyceride transport Biological Process

GO:0048316 seed development Biological Process

GO:0048317 seed morphogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G47730

ath:AT3G47780

ath:AT5G61690

ath:AT5G61730

ddi:DDB_G0291994

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.385

Rank 1 · TkA08G112490 · TK1151

Cell membrane0.299

Rank 2 · TkA08G112490 · TK1151

Cytoplasm0.213

Rank 3 · TkA08G112490 · TK1151

Golgi apparatus0.171

Rank 4 · TkA08G112490 · TK1151

Endoplasmic reticulum0.159

Rank 5 · TkA08G112490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01078Mg_chelatase56-87 aa

PF12698ABC2_membrane_381-296 aa

PF03215Rad17402-436 aa

PF00005ABC_tran403-482 aa

PF03193RsgA_GTPase404-435 aa

PF13476AAA_23408-434 aa

PF13555AAA_29409-432 aa

PF13604AAA_30412-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112490	`PF01078`	Mg_chelatase	56	87	0.12	12.5
TkA08G112490	`PF12698`	ABC2_membrane_3	81	296	3.6e-18	66.5
TkA08G112490	`PF03215`	Rad17	402	436	0.16	12.6
TkA08G112490	`PF00005`	ABC_tran	403	482	4.5e-11	44.2
TkA08G112490	`PF03193`	RsgA_GTPase	404	435	0.27	11.7
TkA08G112490	`PF13476`	AAA_23	408	434	1.7e-05	26.3
TkA08G112490	`PF13555`	AAA_29	409	432	0.22	12.0
TkA08G112490	`PF13604`	AAA_30	412	436	0.29	11.6
TkA08G112490	`PF13304`	AAA_21	415	435	0.015	16.0
TkA08G112490	`PF01078`	Mg_chelatase	416	463	0.12	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K47`	Arabidopsis thaliana	sp\|Q84K47\|AB2A_ARATH ABC transporter A family member 2	70.700%	Swiss-Prot	High
`Q9FKF2`	Arabidopsis thaliana	sp\|Q9FKF2\|AB11A_ARATH ABC transporter A family member 11	64.100%	Swiss-Prot	High
`Q9FLT5`	Arabidopsis thaliana	sp\|Q9FLT5\|AB9A_ARATH ABC transporter A family member 9	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card