TkA08G111470 | RubberDandelionOmics

Gene overview

TkA08G111470

Reference: TK1151 Chr: Chr08 Coordinates: 29002882-29003913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA08G111470|TK1151|cDNA

ATGATATATACCAATCAGTCAAGAATCCCTCAAGAACATCACTATGCTCCATCTTCTTTTTCCTCCTTCCTCCTTCCATCCCCTAATTACATTCCTGTAGAAGATGAAACTCTCTTCTGCAGGTCCTTCCAACAACAACAGTATTTCTCCAACGATCATAACCACCTGCAAGATTCAATCATTCTAGGTGATCATGACATGGCTACAAATGTGGAATCTATCATAGGAATGTGTGGTAGCAACAATGGAGTACTACGACA...

CDS

Download CDS FASTA

963 bp · TkA08G111470|TK1151|CDS

ATGATATATACCAATCAGTCAAGAATCCCTCAAGAACATCACTATGCTCCATCTTCTTTTTCCTCCTTCCTCCTTCCATCCCCTAATTACATTCCTGTAGAAGATGAAACTCTCTTCTGCAGGTCCTTCCAACAACAACAGTATTTCTCCAACGATCATAACCACCTGCAAGATTCAATCATTCTAGGTGATCATGACATGGCTACAAATGTGGAATCTATCATAGGAATGTGTGGTAGCAACAATGGAGTACTACGACA...

Protein

Download Protein FASTA

320 aa · TkA08G111470|TK1151|PROTEIN

MIYTNQSRIPQEHHYAPSSFSSFLLPSPNYIPVEDETLFCRSFQQQQYFSNDHNHLQDSIILGDHDMATNVESIIGMCGSNNGVLRQVARVNDGDDEPYDSSPRKRHSKGDRHSKIDTARGPRDRRMRLSLDVAKKLFGLQDLLGFDKASKTVDWLLTKSKTAILELLPDQSCSFMVFSGISSNKQKEKTSKRVRRTADLRHPLAKATRERARARARERTIEKRNNKLGVVGQDSEYRPSLDDRSIDQDHVNQLGYWNAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G111470`
TK1151 ID	TkA08G111470
OH-1004 ID	LXL04_024238
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.400
Protein coverage (%)	TK1151 20.000 / OH-1004 21.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G111470

Location Chr08:29002882-29003913 (-)

Description Similar to CYC: Transcription factor CYCLOIDEA (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18550`	Transcription factor that prevents axillary bud outgrowth and delays early axillary bud development.	Arabidopsis BRANCHED1 acts as an integrator of branching signals within axillary buds.2007 · DOI: 10.1105/tpc.106.048934 Arabidopsis Teosinte Branched1-like 1 regulates axillary bud outgrowth and is homologous to monocot Teosinte Branched1.2007 · DOI: 10.1093/pcp/pcm044 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024238 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009908 flower development Biological Process

GO:0048262 determination of dorsal/ventral asymmetry Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G67260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA08G111470 · TK1151

Cytoplasm0.098

Rank 2 · TkA08G111470 · TK1151

Cell membrane0.022

Rank 3 · TkA08G111470 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G111470 · TK1151

Plastid0.011

Rank 5 · TkA08G111470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03634TCP108-184 aa

PF03634TCP184-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G111470	`PF03634`	TCP	108	184	9.4e-35	121.2
TkA08G111470	`PF03634`	TCP	184	226	9.4e-35	121.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A1YKT1`	Arabidopsis thaliana	sp\|A1YKT1\|TCP18_ARATH Transcription factor TCP18	73.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card