TkA08G103090 | RubberDandelionOmics

Gene overview

TkA08G103090

Reference: TK1151 Chr: Chr08 Coordinates: 26740337-26745351 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3062 bp · TkA08G103090|TK1151|cDNA

TAATACACAAGAAAAGCATCTGTAGAATAGTGGTAGCAAAAATCGATTCTCTCCTAAATTCTTCCCCTAAAGTTCTTCTTTTGGCGCCAGATTCCAATTTTAACGGTCATGATTTCAACCCGGTTTGTCGTTGTGTGTGTTAGTGTATGAGAGAGATAAAGTAGAGAGATAGAGAGAGGTGCATCAATGGCGGATTCAACAAACGGTTCTTCCAGTTTCTCGACTCAGGCTAACGCTTTGTTCAGGAAGAATTTGACCTT...

CDS

Download CDS FASTA

2841 bp · TkA08G103090|TK1151|CDS

ATGGCGGATTCAACAAACGGTTCTTCCAGTTTCTCGACTCAGGCTAACGCTTTGTTCAGGAAGAATTTGACCTTTCAGAGAAGGAACATCAGGACAAATCTCAGGCTCATATTGTTCCCACTCGTCCTCTGTTTGTTACTTGTATTATTACAAACAATAGTCAACAATGAACTAGATAAACCTGAAAACAAATGTGGTTGCACTTGTATTGACCAAGACGGGGATGGTCAATGCGAGAGAGTGTGCGGGATTGAGTACTC...

Protein

Download Protein FASTA

946 aa · TkA08G103090|TK1151|PROTEIN

MADSTNGSSSFSTQANALFRKNLTFQRRNIRTNLRLILFPLVLCLLLVLLQTIVNNELDKPENKCGCTCIDQDGDGQCERVCGIEYSDLDQVATCAIPTPPEWPPLLQVPAPQYRAVRTNSLSFGDLPNDSCRSTGSCPITVLVTGNNQSLGESLARNIFPISSNFNSSLGLASVVLGSASETQISNFLEPAFFSSRPFYYVQSQCQSNSTFSFPVSVASMEVQKEVRCVQGQHLWRNSSSDINNELYVGYRKGNSEEKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G103090`
TK1151 ID	TkA08G103090
OH-1004 ID	LXL04_031362
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G103090

Location Chr08:26740337-26745351 (-)

Description Similar to ABCA7: ABC transporter A family member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47780`	ABC transporter A family member 7.	No verified direct reference in this release
`At3g47760`	ABC transporter A family member 5.	No verified direct reference in this release
`At3g47740`	ABC transporter A family member 3.	No verified direct reference in this release
`At3g47750`	ABC transporter A family member 4.	No verified direct reference in this release
`At3g47790`	ABC transporter A family member 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031362 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G47740

ath:AT3G47750

ath:AT3G47760

ath:AT3G47780

ath:AT3G47790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.374

Rank 1 · TkA08G103090 · TK1151

Lysosome / Vacuole0.344

Rank 2 · TkA08G103090 · TK1151

Cytoplasm0.176

Rank 3 · TkA08G103090 · TK1151

Golgi apparatus0.152

Rank 4 · TkA08G103090 · TK1151

Endoplasmic reticulum0.150

Rank 5 · TkA08G103090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12698ABC2_membrane_337-53 aa

PF12698ABC2_membrane_3261-553 aa

PF09843DUF2070368-561 aa

PF00005ABC_tran646-790 aa

PF13304AAA_21659-673 aa

PF02463SMC_N660-674 aa

PF13175AAA_15662-682 aa

PF13304AAA_21762-822 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G103090	`PF12698`	ABC2_membrane_3	37	53	2.8e-15	57.0
TkA08G103090	`PF12698`	ABC2_membrane_3	261	553	2.8e-15	57.0
TkA08G103090	`PF09843`	DUF2070	368	561	4.4	6.2
TkA08G103090	`PF00005`	ABC_tran	646	790	1.7e-24	87.7
TkA08G103090	`PF13304`	AAA_21	659	673	2.2e-11	45.0
TkA08G103090	`PF02463`	SMC_N	660	674	0.0034	17.6
TkA08G103090	`PF13175`	AAA_15	662	682	0.031	14.5
TkA08G103090	`PF13304`	AAA_21	762	822	2.2e-11	45.0
TkA08G103090	`PF02463`	SMC_N	773	832	0.0034	17.6
TkA08G103090	`PF13175`	AAA_15	781	821	0.031	14.5
TkA08G103090	`PF13732`	DrrA1-3_C	843	935	0.0031	18.9
TkA08G103090	`PF24526`	ABCA12_C	856	906	1.6e-27	96.1
TkA08G103090	`PF26955`	ACT_13	861	928	0.026	15.3
TkA08G103090	`PF23321`	R1_ABCA1	889	919	0.039	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STT5`	Arabidopsis thaliana	sp\|Q9STT5\|AB7A_ARATH ABC transporter A family member 7	65.100%	Swiss-Prot	High
`Q9STT7`	Arabidopsis thaliana	sp\|Q9STT7\|AB5A_ARATH ABC transporter A family member 5	62.500%	Swiss-Prot	High
`Q1PEH6`	Arabidopsis thaliana	sp\|Q1PEH6\|AB3A_ARATH ABC transporter A family member 3	61.700%	Swiss-Prot	High
`Q9STT8`	Arabidopsis thaliana	sp\|Q9STT8\|AB4A_ARATH ABC transporter A family member 4	62.600%	Swiss-Prot	High
`Q8LPK0`	Arabidopsis thaliana	sp\|Q8LPK0\|AB8A_ARATH ABC transporter A family member 8	62.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card