TkA08G102610 | RubberDandelionOmics

Gene overview

TkA08G102610

Reference: TK1151 Chr: Chr08 Coordinates: 26587108-26589743 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2334 bp · TkA08G102610|TK1151|cDNA

CTAACTATATAGGATGTCAATAAATTTGAAAAATCCCCAATTCAACTACGTTTAGCAAAGGGTTGAAACTTGAAACTGGAGTTGAAGATTACCCCATGCCTTCCTGGCTCCTGGTTTGTTTTCTAGCTTCTCTCTCACCGTAATTATTAGGGCAAAAGAGGAAAAAAGAAACGGTTATGGTGTGAAACACTAACAAAACGCTTTCCTTCTCCAAATCCTTTCTGGTTTCACTACCAATTTCAATCGCAGTACGGCAAAAT...

CDS

Download CDS FASTA

1770 bp · TkA08G102610|TK1151|CDS

ATGCAGAAGCTGCTGCGTCGAAACCCTTGTTCTGCGGCCCCCATCGTATGCCCTCTATCCACTATATTACCCCCTCACGTTTACCTTATCCCTCTAGGGTTTAAGCAAAATAGCAGCAAAAGCACCATACATTCTCTAAGGTTTAAGCATCACAGTCCGGTTTCAGTTCCTTCCTCAATGCCGCCGGCCGCCACCGCTTTACAATTACGTAGTTCCGGTATGCCTCCCACGCTTAGTGGTCCGAATCCCATGGTTTCCAT...

Protein

Download Protein FASTA

589 aa · TkA08G102610|TK1151|PROTEIN

MQKLLRRNPCSAAPIVCPLSTILPPHVYLIPLGFKQNSSKSTIHSLRFKHHSPVSVPSSMPPAATALQLRSSGMPPTLSGPNPMVSMGNYTSSSSSRYVLSSGNRCRICRCSIENATAVPERAWVVLKENRSGSRLSWFRTSSTSSDKGFPVSTKTSENDSGGEADKVFSASDMKSTRLNRRQKSSPPSLLPGNPDLLTIPGVGPRNLRKLVENGIAGVAELKKIYKDKFYGKSNQKMIEFLQSSVGIIHKNHAESITTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G102610`
TK1151 ID	TkA08G102610
OH-1004 ID	LXL04_031351
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G102610`
Location	Chr08:26587108-26589743 (+)
Description	Similar to Dck: Deoxycytidine kinase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031351` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006220 pyrimidine nucleotide metabolic process Biological Process GO:0008617 guanosine metabolic process Biological Process GO:0032261 purine nucleotide salvage Biological Process GO:0042775 mitochondrial ATP synthesis coupled electron transport Biological Process GO:0043173 nucleotide salvage Biological Process GO:0046092 deoxycytidine metabolic process Biological Process GO:0046122 purine deoxyribonucleoside metabolic process Biological Process GO:0106383 dAMP salvage Biological Process GO:0106384 dGMP salvage Biological Process GO:1901293 nucleoside phosphate biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	bta:530642 hsa:1633 hsa:1716 mmu:13178 rno:79127 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.601

Rank 1 · TkA08G102610 · TK1151

Plastid0.324

Rank 2 · TkA08G102610 · TK1151

Nucleus0.093

Rank 3 · TkA08G102610 · TK1151

Cytoplasm0.046

Rank 4 · TkA08G102610 · TK1151

Cell membrane0.016

Rank 5 · TkA08G102610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14520HHH_5196-223 aa

PF16413Mlh1_C210-227 aa

PF26555HTH_78232-268 aa

PF02367TsaE282-308 aa

PF01712dNK288-542 aa

PF13238AAA_18290-446 aa

PF02223Thymidylate_kin414-460 aa

PF16413Mlh1_C506-550 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G102610	`PF14520`	HHH_5	196	223	0.0043	18.2
TkA08G102610	`PF16413`	Mlh1_C	210	227	0.11	12.7
TkA08G102610	`PF26555`	HTH_78	232	268	0.031	14.8
TkA08G102610	`PF02367`	TsaE	282	308	0.16	12.6
TkA08G102610	`PF01712`	dNK	288	542	1.3e-50	172.8
TkA08G102610	`PF13238`	AAA_18	290	446	0.079	14.2
TkA08G102610	`PF02223`	Thymidylate_kin	414	460	0.12	12.8
TkA08G102610	`PF16413`	Mlh1_C	506	550	0.11	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card