TkA08G102500 | RubberDandelionOmics

Gene overview

TkA08G102500

Reference: TK1151 Chr: Chr08 Coordinates: 26566711-26571091 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3245 bp · TkA08G102500|TK1151|cDNA

CTATTTATATAAAAATATATATAATATAGGAAGATTTATGAAAAAAACTCAAAACAAAAAGCTCTCCATAGTAGAGTTTTTTATTATAAATATGTGTTTGGAAAAAAAAACTCTAAAAAAAGCATTAACATTGTGGATGCTCTTATAATCGTGTCTCGATATATTGGATTGCTAATTTTATTGCTTTTGTCACATTAAAAAATATAATGTCTTGTAAATATACTATTTTCCACACCACCTACGTTTCAGATCCAGTCTTC...

CDS

Download CDS FASTA

1320 bp · TkA08G102500|TK1151|CDS

ATGATGAACGTATGGAACATGAAGGCGCGTCAATCTTGGAAGCCTTGTATTCCCCTCCAGAATTCTGAAACAGAATTACCAAAATCAAATGGGTTCCTCATAATTGAAGCAAATGGGGGGCTGAATCAACAAAGATTATCGATATGTGATGCGGTGGGAGTTGCAGGGCTACTAAATGCCACACTTGTAATTCCAATGTTTCATTTGAACAGTGTATGGCGTGATTCAAGCAAATTTGGAGATATATTTGACGAAGAGTT...

Protein

Download Protein FASTA

439 aa · TkA08G102500|TK1151|PROTEIN

MMNVWNMKARQSWKPCIPLQNSETELPKSNGFLIIEANGGLNQQRLSICDAVGVAGLLNATLVIPMFHLNSVWRDSSKFGDIFDEEFFIYALRSHVNVIRELPEDVLARFDNNISNIVNLRVKGWSSPTYYLQKVLPKLMELGAVRIAPFSNRLAHAVPSDIQGHRCLSNFEALRFSEPIRTLAAKMVDRMIRNSSTSGGKYISVHLRFEEDMVAFSCCVYDGGEGEQREMDIARERSWRGKFRKKNRIIKPGAIRMDGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G102500`
TK1151 ID	TkA08G102500
OH-1004 ID	LXL04_031347
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 30.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G102500

Location Chr08:26566711-26571091 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g35510`	O-fucosyltransferase 9.	No verified direct reference in this release
`At2g01480`	Glycosyltransferase that plays a role in cell adhesion.	No verified direct reference in this release
`At1g14970`	O-fucosyltransferase 4.	No verified direct reference in this release
`At1g38131`	O-fucosyltransferase 11.	No verified direct reference in this release
`At1g38065`	O-fucosyltransferase 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031347 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0007155 cell adhesion Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14970

ath:AT1G35510

ath:AT1G38065

ath:AT1G38131

ath:AT2G01480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.820

Rank 1 · TkA08G102500 · TK1151

Endoplasmic reticulum0.066

Rank 2 · TkA08G102500 · TK1151

Cell membrane0.059

Rank 3 · TkA08G102500 · TK1151

Extracellular0.046

Rank 4 · TkA08G102500 · TK1151

Cytoplasm0.042

Rank 5 · TkA08G102500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT32-361 aa

PF17843MycE_N178-227 aa

PF13589HATPase_c_3190-228 aa

PF17843MycE_N261-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G102500	`PF10250`	O-FucT	32	361	3.4e-97	326.9
TkA08G102500	`PF17843`	MycE_N	178	227	0.26	12.7
TkA08G102500	`PF13589`	HATPase_c_3	190	228	0.24	12.1
TkA08G102500	`PF17843`	MycE_N	261	293	0.26	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1E6`	Arabidopsis thaliana	sp\|Q8H1E6\|OFUT9_ARATH O-fucosyltransferase 9	74.100%	Swiss-Prot	High
`Q9ZVF7`	Arabidopsis thaliana	sp\|Q9ZVF7\|ESMD1_ARATH Protein ESMERALDA 1	60.100%	Swiss-Prot	High
`F4HXW9`	Arabidopsis thaliana	sp\|F4HXW9\|OFUT4_ARATH O-fucosyltransferase 4	60.200%	Swiss-Prot	High
`Q8GUM0`	Arabidopsis thaliana	sp\|Q8GUM0\|OFT11_ARATH O-fucosyltransferase 11	56.800%	Swiss-Prot	High
`Q8LNP3`	Arabidopsis thaliana	sp\|Q8LNP3\|OFT10_ARATH O-fucosyltransferase 10	58.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card