TkA08G101940 | RubberDandelionOmics

Gene overview

TkA08G101940

Reference: TK1151 Chr: Chr08 Coordinates: 26440210-26443387 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2911 bp · TkA08G101940|TK1151|cDNA

CTTTTCTATATACGCACCGTGTGATTTGTTTATATTATTTGTTTGAATTCAACAACGCTGCAGAAAGTGTAGAATTTTCTAACCTGACCATTTTCTAAGACACCAAATAGACGTGTTGCGTTCATCACGCGTACGAAATCTCAACAGTCTTCCTCTCTCTCCCTCCATTCTCTGTGTGTGTTTGTTTTTTGCTTTCAATCTTGCATTAGAATAGTACCAAAACTTGTAATTAGAGCTGTCAATATACATATATGTATAAA...

CDS

Download CDS FASTA

1512 bp · TkA08G101940|TK1151|CDS

ATGGGCTGCGGAGGTTCTAAAATCGACGATTTGCCATTGGTGATACGTTGTAGAGCTAGAAAGGAAATGATCAAGTCTGCGATGGACTACCGGTATGATTTGTCTTCTTCACATGTCGCTTATTTCCGATCTCTTACGGACATCAGCGATGCACTGTCTCGATTTGTTGATGAAGAACTCGTAGTCAATTCATCCTCTGCGTCTTCCCCTGTACTCACATTACCATCCGATGAAAGTTCCATTTCACATATTCATTCCAT...

Protein

Download Protein FASTA

503 aa · TkA08G101940|TK1151|PROTEIN

MGCGGSKIDDLPLVIRCRARKEMIKSAMDYRYDLSSSHVAYFRSLTDISDALSRFVDEELVVNSSSASSPVLTLPSDESSISHIHSIDGNEDSHLHLSSDSESDLHSYSGSHIHIVDDDSVPRNESKSPLSSLYNHNQNNWDNGFVLNGDPPSYSGGWGPYGGIFYPQSRSSNFYYMKKSAPASNTVLHKEERGFQQTGQWPDSSQYNPNLHESGSFYGFSMNRSSPPEESKQQKPTKTPSPPPPPKVNAWDFFNFFDGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101940`
TK1151 ID	TkA08G101940
OH-1004 ID	LXL04_031336
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 98.608 / OH-1004 60.121 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G101940`
Location	Chr08:26440210-26443387 (-)
Description	Similar to APSR1: Protein ALTERED PHOSPHATE STARVATION RESPONSE 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031336` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0010073 meristem maintenance Biological Process GO:0010167 response to nitrate Biological Process GO:0015706 nitrate transmembrane transport Biological Process GO:0030154 cell differentiation Biological Process GO:0071249 cellular response to nitrate Biological Process GO:0071705 nitrogen compound transport Biological Process GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT3G51290 ath:AT3G60320 dosa:Os10g0562700 osa:4349394 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.375

Rank 1 · TkA08G101940 · TK1151

Cytoplasm0.354

Rank 2 · TkA08G101940 · TK1151

Nucleus0.331

Rank 3 · TkA08G101940 · TK1151

Endoplasmic reticulum0.091

Rank 4 · TkA08G101940 · TK1151

Golgi apparatus0.059

Rank 5 · TkA08G101940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04783DUF6301-59 aa

PF04782DUF63232-61 aa

PF04782DUF632323-346 aa

PF04782DUF632396-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101940	`PF04783`	DUF630	1	59	2.8e-22	79.3
TkA08G101940	`PF04782`	DUF632	32	61	1.7e-20	74.2
TkA08G101940	`PF04782`	DUF632	323	346	1.7e-20	74.2
TkA08G101940	`PF04782`	DUF632	396	497	1.7e-20	74.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card