TkA08G097740 | RubberDandelionOmics

Gene overview

TkA08G097740

Reference: TK1151 Chr: Chr08 Coordinates: 25291085-25291570 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA08G097740|TK1151|cDNA

ATGGTTTTATTGGAGATCGTGTCGGGTAGACGGAACTTCGAGGTTTCCGATCGGACAAACCGGAAGAAGTTTTCCGTTTGGGCGTACGAGGAATTCGAAAAGGGTTCCATTGACTCAATTATCGACCCGAAGATTCTGACCCATGAATTCGACATGGGTCAGATACGTCGGGTGATCGAAGTTAGCTTTTGGTGTATTCAAGAACAACCGTCACAGAGACCGATGATGGGGAAAGTGGTTCAGATGTTGGAAGGTGTGAC...

CDS

Download CDS FASTA

486 bp · TkA08G097740|TK1151|CDS

ATGGTTTTATTGGAGATCGTGTCGGGTAGACGGAACTTCGAGGTTTCCGATCGGACAAACCGGAAGAAGTTTTCCGTTTGGGCGTACGAGGAATTCGAAAAGGGTTCCATTGACTCAATTATCGACCCGAAGATTCTGACCCATGAATTCGACATGGGTCAGATACGTCGGGTGATCGAAGTTAGCTTTTGGTGTATTCAAGAACAACCGTCACAGAGACCGATGATGGGGAAAGTGGTTCAGATGTTGGAAGGTGTGAC...

Protein

Download Protein FASTA

161 aa · TkA08G097740|TK1151|PROTEIN

MVLLEIVSGRRNFEVSDRTNRKKFSVWAYEEFEKGSIDSIIDPKILTHEFDMGQIRRVIEVSFWCIQEQPSQRPMMGKVVQMLEGVTEIEKPPAPKAGSTVDGSVAGTSTNMSSSVSTFAPSVLPQSSSSSIQTPKGSSFASGMNIERASSSLLQSQSVTM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G097740`
TK1151 ID	TkA08G097740
OH-1004 ID	LXL04_031261
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.168 / OH-1004 13.381 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G097740

Location Chr08:25291085-25291570 (-)

Description Similar to At1g34300: G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XQD3`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release
`Os04g0202300`	Involved in resistance against the herbivorous insect brown planthopper (N.lugens, BPH).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031261 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT2G19130

ath:AT4G00340

ath:AT4G32300

ath:AT5G24080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.505

Rank 1 · TkA08G097740 · TK1151

Cytoplasm0.369

Rank 2 · TkA08G097740 · TK1151

Nucleus0.272

Rank 3 · TkA08G097740 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA08G097740 · TK1151

Golgi apparatus0.046

Rank 5 · TkA08G097740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	62.700%	Swiss-Prot	Medium
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	42.900%	Swiss-Prot	Medium
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	41.200%	Swiss-Prot	Medium
`A2XQD3`	Oryza sativa subsp. indica	sp\|A2XQD3\|LERK2_ORYSI G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	35.000%	Swiss-Prot	Medium
`Q7FAZ2`	Oryza sativa subsp. japonica	sp\|Q7FAZ2\|LERK2_ORYSJ G-type lectin S-receptor-like serine/threonine-protein kinase LECRK2	35.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card