TkA08G097460 | RubberDandelionOmics

Gene overview

TkA08G097460

Reference: TK1151 Chr: Chr08 Coordinates: 25205162-25208007 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2209 bp · TkA08G097460|TK1151|cDNA

AGGTGAAACCAAACAGAAATTAACAAGCAAAAACAAAATCAAATCATGAACAGGATACATATCTAGCGGAGCAGTTTCCAATGCCCATTCCCGACGATGAATTCAAAGCATCACCGAATGCATATTTTCTGTTCCACTGCTCATAAATCACCATGCCTGAACCTGAACCTGAACCCTCCTTCTTCATTGAATCTCCGATGGAGACCGACAGTGCTGAAAACAGCGATCTTTACGTCCTCTCCATCCCTCAAGCCGGCCGC...

CDS

Download CDS FASTA

906 bp · TkA08G097460|TK1151|CDS

ATGAAAGATGAATGTGGGGGAGAAGCTAGAAGCTTTTATAACTCAACAGGATACAAAGATGAGTTAGTATGGGGAGGGACGTGGTTGTTTTTCGCTACCGGAAATACGAGCTATCTTAGATACGCCACTGAACATCTTGCCGGAGCTGAAGAAGATGAACTATCAGCCGATAAAGGGATTTTCTATTGGAATAATAAGCTCACTGCAGTCGCGGTTTTGTTAACAAGACTCAGATTCTTCTTTGATCTTGGATACCCGTA...

Protein

Download Protein FASTA

301 aa · TkA08G097460|TK1151|PROTEIN

MKDECGGEARSFYNSTGYKDELVWGGTWLFFATGNTSYLRYATEHLAGAEEDELSADKGIFYWNNKLTAVAVLLTRLRFFFDLGYPYEDSFILSTNKVDSLMCSYMSPTTHKTQGGLIFLKPNDYGSLEYAATSSFLSKLYSDYLDLLHRSGIECVDGTSFSLKQLRDFSVSQVNYILGDNPMGMSYVVGYGNNYPKQVHHRGASIAWDNQWHSCAEGSAWLNSKNSNPNEVLGAMVRGPDENDMFLDDRRKPWFTEPTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G097460`
TK1151 ID	TkA08G097460
OH-1004 ID	LXL04_031255
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.900
Protein coverage (%)	TK1151 100.000 / OH-1004 50.681 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G097460

Location Chr08:25205162-25208007 (-)

Description Similar to GLU1: Endoglucanase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24260`	Endoglucanase 21.	No verified direct reference in this release
`At5g49720`	Required for cellulose microfibril formation.	KORRIGAN, an Arabidopsis endo-1,4-beta-glucanase, localizes to the cell plate by polarized targeting and is essential for cytokinesis.2000 · DOI: 10.1105/tpc.12.7.1137 Temperature-sensitive alleles of RSW2 link the KORRIGAN endo-1,4-beta-glucanase to cellulose synthesis and cytokinesis in Arabidopsis.2001 · DOI: 10.1104/pp.126.1.278 An Arabidopsis endo-1,4-beta-D-glucanase involved in cellulose synthesis undergoes regulated intracellular cycling.2005 · DOI: 10.1105/tpc.105.036228

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0329500`	Involved in cell wall assembly during cell elongation.	OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation.2006 · DOI: 10.1007/s11103-005-2972-x
`Os03g0736300`	Endoglucanase 10.	No verified direct reference in this release
`Os04g0497200`	Endoglucanase 12.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048367 shoot system development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

KEGG gene cross-reference

ath:AT4G24260

ath:AT5G49720

dosa:Os03g0329500

dosa:Os03g0736300

dosa:Os04g0497200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.458

Rank 1 · TkA08G097460 · TK1151

Cell membrane0.187

Rank 2 · TkA08G097460 · TK1151

Lysosome / Vacuole0.155

Rank 3 · TkA08G097460 · TK1151

Endoplasmic reticulum0.126

Rank 4 · TkA08G097460 · TK1151

Cytoplasm0.107

Rank 5 · TkA08G097460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759Glyco_hydro_99-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G097460	`PF00759`	Glyco_hydro_9	9	270	6.1e-63	214.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STW8`	Arabidopsis thaliana	sp\|Q9STW8\|GUN21_ARATH Endoglucanase 21	49.300%	Swiss-Prot	Medium
`Q38890`	Arabidopsis thaliana	sp\|Q38890\|GUN25_ARATH Endoglucanase 25	46.500%	Swiss-Prot	Medium
`P0C1U4`	Oryza sativa subsp. japonica	sp\|P0C1U4\|GUN9_ORYSJ Endoglucanase 9	47.400%	Swiss-Prot	Medium
`Q84R49`	Oryza sativa subsp. japonica	sp\|Q84R49\|GUN10_ORYSJ Endoglucanase 10	45.300%	Swiss-Prot	Medium
`Q7XUK4`	Oryza sativa subsp. japonica	sp\|Q7XUK4\|GUN12_ORYSJ Endoglucanase 12	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card