TkA08G090990 | RubberDandelionOmics

Gene overview

TkA08G090990

Reference: TK1151 Chr: Chr08 Coordinates: 23537321-23539002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1209 bp · TkA08G090990|TK1151|cDNA

AAAACCACTCTGCCAAGAAATGGGAAGATCTCCTTCTTCTGAAGAAAACAACCTCAAAAAGGGTCCATGGACTCCTGAAGAAGATCAAAAGCTGACTGATTACATTCAGAAACATGGCCATGGCAGTTGGAGAGCTCTCCCTAAACTTGCCGGTCTGAAAAGATGTGGAAAGAGTTGCAGACTGAGATGGACGAATTATCTGAGACCAGATATCAAGCGAGGAAAATTCTCAAACGAAGAAGAGAACACCATTCTTCACC...

CDS

Download CDS FASTA

936 bp · TkA08G090990|TK1151|CDS

ATGGGAAGATCTCCTTCTTCTGAAGAAAACAACCTCAAAAAGGGTCCATGGACTCCTGAAGAAGATCAAAAGCTGACTGATTACATTCAGAAACATGGCCATGGCAGTTGGAGAGCTCTCCCTAAACTTGCCGGTCTGAAAAGATGTGGAAAGAGTTGCAGACTGAGATGGACGAATTATCTGAGACCAGATATCAAGCGAGGAAAATTCTCAAACGAAGAAGAGAACACCATTCTTCACCTTCACTCCATTCTTGGAAA...

Protein

Download Protein FASTA

311 aa · TkA08G090990|TK1151|PROTEIN

MGRSPSSEENNLKKGPWTPEEDQKLTDYIQKHGHGSWRALPKLAGLKRCGKSCRLRWTNYLRPDIKRGKFSNEEENTILHLHSILGNKWSAIAAHLPGRTDNEIKNYWNTHLKKRLIQMGIDPMTHQPKTDLFSCLPQLIALANLKELLEQTQLAHNLQYFNLLRQPLAIAENNPDLATALNTINQEPDPYFSNNSLQVGQERVEMSDFFSVENAAVAIGGGGSQPLQQQVPFDQEDVVQSQMGLINDKSSSSTWNLLPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G090990`
TK1151 ID	TkA08G090990
OH-1004 ID	LXL04_031167
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G090990

Location Chr08:23537321-23539002 (+)

Description Similar to MYB93: Transcription factor MYB93

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34670`	Transcription factor that acts as a negative regulator of lateral root (LR) development.	AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.2014 · DOI: 10.1111/nph.12879
`At5g65230`	Probable transcription factor.	No verified direct reference in this release
`At5g10280`	Probable transcription factor.	No verified direct reference in this release
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:1901332 negative regulation of lateral root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G34670

ath:AT4G05100

ath:AT4G21440

ath:AT5G10280

ath:AT5G65230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926

Rank 1 · TkA08G090990 · TK1151

Cytoplasm0.172

Rank 2 · TkA08G090990 · TK1151

Cell membrane0.023

Rank 3 · TkA08G090990 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G090990 · TK1151

Mitochondrion0.013

Rank 5 · TkA08G090990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_711-33 aa

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-76 aa

PF23588HTH_CHD1_Hrp317-40 aa

PF08914Myb_Rap117-34 aa

PF08914Myb_Rap152-64 aa

PF15963Myb_DNA-bind_766-115 aa

PF00249Myb_DNA-binding67-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G090990	`PF15963`	Myb_DNA-bind_7	11	33	0.056	14.0
TkA08G090990	`PF00249`	Myb_DNA-binding	14	61	6.3e-38	129.4
TkA08G090990	`PF13921`	Myb_DNA-bind_6	17	76	1.4e-21	77.1
TkA08G090990	`PF23588`	HTH_CHD1_Hrp3	17	40	0.018	15.8
TkA08G090990	`PF08914`	Myb_Rap1	17	34	0.19	12.9
TkA08G090990	`PF08914`	Myb_Rap1	52	64	0.19	12.9
TkA08G090990	`PF15963`	Myb_DNA-bind_7	66	115	0.056	14.0
TkA08G090990	`PF00249`	Myb_DNA-binding	67	112	6.3e-38	129.4
TkA08G090990	`PF13921`	Myb_DNA-bind_6	73	114	1.4e-21	77.1
TkA08G090990	`PF08914`	Myb_Rap1	73	87	0.19	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9Z2`	Arabidopsis thaliana	sp\|Q9S9Z2\|MYB93_ARATH Transcription factor MYB93	76.800%	Swiss-Prot	Medium
`Q9FJP2`	Arabidopsis thaliana	sp\|Q9FJP2\|MYB53_ARATH Transcription factor MYB53	61.500%	Swiss-Prot	Medium
`Q9SBF3`	Arabidopsis thaliana	sp\|Q9SBF3\|MYB92_ARATH Transcription factor MYB92	57.900%	Swiss-Prot	Medium
`Q9LDR8`	Arabidopsis thaliana	sp\|Q9LDR8\|MY102_ARATH Transcription factor MYB102	78.000%	Swiss-Prot	Low
`Q9M0Y5`	Arabidopsis thaliana	sp\|Q9M0Y5\|MYB74_ARATH Transcription factor MYB74	78.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card