TkA08G089260 | RubberDandelionOmics

Gene overview

TkA08G089260

Reference: TK1151 Chr: Chr08 Coordinates: 23122596-23125559 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · TkA08G089260|TK1151|cDNA

TAAAGAAAACAACGCTCCACTTTTAGTTCTTATATATCACTTGCATTGTTGCATACCGAGCATGTTTTATTTCTTAAGAAAATTTATTGTGGTAGAAAAAATATGAGTCATAGTTTCTGAAAAAAAAATCAAGAATTTAGATTTATGGATCATCAAAAAAAAACCACCATCACCGGCACCACTGTATCACCGATGGAAAAAGCTAATCCGGCCGCCAAGAAAAACCTCTTAATCCTCCATTGCATCCTATTATCGATCGG...

CDS

Download CDS FASTA

1101 bp · TkA08G089260|TK1151|CDS

ATGGATCATCAAAAAAAAACCACCATCACCGGCACCACTGTATCACCGATGGAAAAAGCTAATCCGGCCGCCAAGAAAAACCTCTTAATCCTCCATTGCATCCTATTATCGATCGGAAACTGCAGCGGCCCATTAGTGATGCGCCTCTACTTTATCCATGGTGGCCAACGCATCTGGCTCATCGGATTCATCGAGACCGTCGGTTGGCCATTGATTTTTATCATCCTCATTATTCTCTACTTCAACCGCCGTTTCACCGG...

Protein

Download Protein FASTA

366 aa · TkA08G089260|TK1151|PROTEIN

MDHQKKTTITGTTVSPMEKANPAAKKNLLILHCILLSIGNCSGPLVMRLYFIHGGQRIWLIGFIETVGWPLIFIILIILYFNRRFTGRNNGNNHPITFIYMRWRLFMAVALIGVLTGLDNYLYSYGIAHLPVSTYALINASRLVFMAVFAFILVKQKFTPYSINAVVLLTVGSAVLAFHSSGDRPKGESKGEYVMGFLMTVAAAALYGLVSPLVELTYKKAKQEITYTLVLEVQMVMCLFATVFCMVGMIFNDDFKAIPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G089260`
TK1151 ID	TkA08G089260
OH-1004 ID	LXL04_031139
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 68.852 / OH-1004 31.579 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G089260

Location Chr08:23122596-23125559 (+)

Description Similar to PUP3: Purine permease 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At1g28220`	May be involved in transport of purine derivatives during pollen germination and tube elongation.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At2g33750`	Mediates adenine transport.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At4g18210`	Probable purine permease 10.	No verified direct reference in this release
`At1g44750`	Probable purine permease 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031139 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.463

Rank 1 · TkA08G089260 · TK1151

Lysosome / Vacuole0.200

Rank 2 · TkA08G089260 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA08G089260 · TK1151

Golgi apparatus0.112

Rank 4 · TkA08G089260 · TK1151

Cytoplasm0.108

Rank 5 · TkA08G089260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913PUNUT28-351 aa

PF04478Mid260-81 aa

PF00892EamA61-176 aa

PF04142Nuc_sug_transp102-317 aa

PF00892EamA195-341 aa

PF04478Mid2300-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G089260	`PF16913`	PUNUT	28	351	9.5e-103	344.5
TkA08G089260	`PF04478`	Mid2	60	81	3.2	8.2
TkA08G089260	`PF00892`	EamA	61	176	9.8e-09	36.3
TkA08G089260	`PF04142`	Nuc_sug_transp	102	317	7.3e-06	26.0
TkA08G089260	`PF00892`	EamA	195	341	9.8e-09	36.3
TkA08G089260	`PF04478`	Mid2	300	323	3.2	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ96`	Arabidopsis thaliana	sp\|Q9FZ96\|PUP1_ARATH Purine permease 1	57.300%	Swiss-Prot	High
`Q9FZ95`	Arabidopsis thaliana	sp\|Q9FZ95\|PUP3_ARATH Purine permease 3	53.700%	Swiss-Prot	High
`Q94GB1`	Arabidopsis thaliana	sp\|Q94GB1\|PUP2_ARATH Purine permease 2	48.400%	Swiss-Prot	Medium
`O49725`	Arabidopsis thaliana	sp\|O49725\|PUP10_ARATH Probable purine permease 10	34.300%	Swiss-Prot	Medium
`Q9LPF6`	Arabidopsis thaliana	sp\|Q9LPF6\|PUP11_ARATH Probable purine permease 11	29.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card