TkA08G087850 | RubberDandelionOmics

Gene overview

TkA08G087850

Reference: TK1151 Chr: Chr08 Coordinates: 22769062-22778000 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3498 bp · TkA08G087850|TK1151|cDNA

CTTGACTCGAGCTAGACTATGTCAAGAAATGTGTCACGGTCGCAGTCCGTCGTGCACCCCGGACTTCTATTGACAGAGGCGCACCTGAGGCGGGAACTTTAAGCCCGCCCGGCCCACTGTGTCATACTACCTTTTTCTACCAAAGAGCTCAGCAACACACCACTCGGGATTTCACGTTATTTTTCCTTCTCATTTCGTATTGTAGAGCGACGATTGTGCGGACTGCCGAGGGTTTTTCGCGATGGCGGCATCGTCGAGTT...

CDS

Download CDS FASTA

480 bp · TkA08G087850|TK1151|CDS

ATGGATTCAGAACTACCCCTATCTTTAAAATACTGTTCTGGATCAACCCCATCATCTGAAGCAACCATGAACGATGAAGTACACAAACTCATCCATAACCTAGTACTACACATCCACAAAAACGAACCAGACATGGAGAAAAGCATCTTGATATTCCTTCCAACTTACAGTGCTTTAGAGCAACAATGGCTTGCTTTGAGTCGTTTCAGCAGTGCTTTTAAAGTTCACATCTTACATAGCAGCATTGACACAGAGCAAGC...

Protein

Download Protein FASTA

159 aa · TkA08G087850|TK1151|PROTEIN

MDSELPLSLKYCSGSTPSSEATMNDEVHKLIHNLVLHIHKNEPDMEKSILIFLPTYSALEQQWLALSRFSSAFKVHILHSSIDTEQALNAMRISKSHRKVILATNIAESSVTIPKVAYVIDSCRSLQVYWDANRKPNQQRLFGFLNLRLNRGGENRSHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087850`
TK1151 ID	TkA08G087850
OH-1004 ID	LXL04_018888
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.906 / OH-1004 14.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G087850

Location Chr08:22769062-22778000 (+)

Description Similar to At2g47680: DExH-box ATP-dependent RNA helicase DExH8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47680`	DExH-box ATP-dependent RNA helicase DExH8.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0256800`	Zinc finger CCCH domain-containing protein 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018888 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001731 formation of translation preinitiation complex Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0042255 ribosome assembly Biological Process

GO:0045948 positive regulation of translational initiation Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016282 eukaryotic 43S preinitiation complex Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

KEGG gene cross-reference

aag:5577484

ath:AT2G47680

hsa:54505

mmu:218629

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · TkA08G087850 · TK1151

Nucleus0.503

Rank 2 · TkA08G087850 · TK1151

Mitochondrion0.076

Rank 3 · TkA08G087850 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA08G087850 · TK1151

Cell membrane0.031

Rank 5 · TkA08G087850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09984sCache_418-151 aa

PF22614Slo-like_RCK26-107 aa

PF11667DUF326727-65 aa

PF00271Helicase_C42-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087850	`PF09984`	sCache_4	18	151	0.0038	17.7
TkA08G087850	`PF22614`	Slo-like_RCK	26	107	0.0053	17.1
TkA08G087850	`PF11667`	DUF3267	27	65	0.24	12.5
TkA08G087850	`PF00271`	Helicase_C	42	123	1.3e-10	42.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22243`	Arabidopsis thaliana	sp\|O22243\|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8	69.000%	Swiss-Prot	High
`Q1EHT7`	Oryza sativa subsp. japonica	sp\|Q1EHT7\|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4	68.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card