Gene Card
Gene overview
cDNA / CDS / Protein Sequences
476 bp · TkA08G087470|TK1151|cDNA
AAGCACACAATATATAATCCACACAGAGACGCGGGGAGATAGAGAGATCGGTGGTGACGGAGACGGCGACGGTGAGAACAGTCGGCGATCAACTGATGAAGACTACGATTTTGAAGAGGAAGAGGAGCGGTAGTAGCAGAAAGGAAACGCAGAAGAGGATGAAAGGTTCGCTGGCTAGACACTTATCGGCTCAGCTAGGTCAAATCTCTTTCAAGCCGCCGCTTCCTCAGAATAGTAACAATCCTTCGCGGTTTCAGAAT...
381 bp · TkA08G087470|TK1151|CDS
ATGAAGACTACGATTTTGAAGAGGAAGAGGAGCGGTAGTAGCAGAAAGGAAACGCAGAAGAGGATGAAAGGTTCGCTGGCTAGACACTTATCGGCTCAGCTAGGTCAAATCTCTTTCAAGCCGCCGCTTCCTCAGAATAGTAACAATCCTTCGCGGTTTCAGAATCTTCCGGATTACGAGGCTCCCGATACATCGGAATCAGCCCCGTCTACATCGTCGTTTCCGTCGGCGACGGTTCTAGATTTCGATACCGATGTCAA...
Protein
Download Protein FASTA127 aa · TkA08G087470|TK1151|PROTEIN
MKTTILKRKRSGSSRKETQKRMKGSLARHLSAQLGQISFKPPLPQNSNNPSRFQNLPDYEAPDTSESAPSTSSFPSATVLDFDTDVNVDEKNFILSQDFFCTPDYITPEAPPLPVTLGCDKMEELPC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G087470 |
|---|---|
| TK1151 ID | TkA08G087470 |
| OH-1004 ID | LXL04_018875 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 25.971Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G087470 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:22649532-22650575 (-) | ||||||||||||
| Description | Similar to WEE1: Wee1-like protein kinase | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000076 DNA replication checkpoint signaling Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0051301 cell division Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0060631 regulation of meiosis I Biological Process GO:1902750 negative regulation of cell cycle G2/M phase transition Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004672 protein kinase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G02970 dosa:Os02g0135300 dre:327471 xla:398396 xla:399355 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.