TkA08G087170 | RubberDandelionOmics

Gene overview

TkA08G087170

Reference: TK1151 Chr: Chr08 Coordinates: 22523020-22528009 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · TkA08G087170|TK1151|cDNA

ATGGGCTTAAACGAGTCCTTTAAATTAGATTGGCTTAAGAGACTAAAAAAGGAGCATAATATTTCTTTATGTGGTATCCAAGAGTCTAGGTTTTCTTCCCTTCCTCTGAAATTTTGGGGTGTTACATGGGGGAACCAGGACCTTGGTTTAGATTTCGTGGAATCTGTTGGAAAATCAGGGGGGTTAATTTGCTTCTGGGACAAAGTGTTATTTCAAGACATTGCGGTGATTAAATCTCGGTTTTTCATAGCCATAGTTGG...

CDS

Download CDS FASTA

1818 bp · TkA08G087170|TK1151|CDS

ATGGGCTTAAACGAGTCCTTTAAATTAGATTGGCTTAAGAGACTAAAAAAGGAGCATAATATTTCTTTATGTGGTATCCAAGAGTCTAGGTTTTCTTCCCTTCCTCTGAAATTTTGGGGTGTTACATGGGGGAACCAGGACCTTGGTTTAGATTTCGTGGAATCTGTTGGAAAATCAGGGGGGTTAATTTGCTTCTGGGACAAAGTGTTATTTCAAGACATTGCGGTGATTAAATCTCGGTTTTTCATAGCCATAGTTGG...

Protein

Download Protein FASTA

605 aa · TkA08G087170|TK1151|PROTEIN

MGLNESFKLDWLKRLKKEHNISLCGIQESRFSSLPLKFWGVTWGNQDLGLDFVESVGKSGGLICFWDKVLFQDIAVIKSRFFIAIVGYWNGVPGETIFVNVYAPQAPAEKKRLWADLLNLMNSRTGNWVFLGDFNAVRRSDERYNSVFCPNIAVAFNKFILDAGLIEMNMGGRKFTYFCDDGVKLSKLDRILVCSNFMAAFPTASILALPREYSDHCLVLLRTSFMDFGAPLFRFFNSWLYRDGIENLVRQTWADFDGIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G087170`
TK1151 ID	TkA08G087170
OH-1004 ID	LXL04_014455
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 93.388 / OH-1004 30.359 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G087170`
Location	Chr08:22523020-22528009 (+)
Description	Similar to Os01g0810000: Probable U3 small nucleolar RNA-associated protein 11
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014455` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006364 rRNA processing Biological Process GO:0009561 megagametogenesis Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0003723 RNA binding Molecular Function GO:0003824 catalytic activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function
KEGG gene cross-reference	ath:AT3G60360 dosa:Os01g0810000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · TkA08G087170 · TK1151

Nucleus0.338

Rank 2 · TkA08G087170 · TK1151

Plastid0.064

Rank 3 · TkA08G087170 · TK1151

Cell membrane0.044

Rank 4 · TkA08G087170 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA08G087170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos20-216 aa

PF14529Exo_endo_phos_297-217 aa

PF05951Peptidase_M15_2263-314 aa

PF00078RVT_1286-322 aa

PF01082Cu2_monooxygen413-456 aa

PF00078RVT_1474-586 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G087170	`PF03372`	Exo_endo_phos	20	216	6.3e-10	39.9
TkA08G087170	`PF14529`	Exo_endo_phos_2	97	217	0.009	16.6
TkA08G087170	`PF05951`	Peptidase_M15_2	263	314	0.22	12.0
TkA08G087170	`PF00078`	RVT_1	286	322	9.8e-12	45.9
TkA08G087170	`PF01082`	Cu2_monooxygen	413	456	0.21	12.5
TkA08G087170	`PF00078`	RVT_1	474	586	9.8e-12	45.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card