TkA08G084120 | RubberDandelionOmics

Gene overview

TkA08G084120

Reference: TK1151 Chr: Chr08 Coordinates: 21666171-21670487 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · TkA08G084120|TK1151|cDNA

TGCATGGTGCACCCAACACCTTCAATGGCCAAACAGCTTCGCTTTTCCGATCACTCAACTGAAGTTCCCAAGCGTAATTACGATCAATTAAACATCGACTCGATACTTGAATCCCTGTTTGCTGTTTCCGATTACGGTTTAATCGACGCCTCATTCGATGGCCTGGTCAAATCTAGGTCTAGCGATTCCCACCAAGACGATTTTATCCAACGTGCTCTCCACCTCGGATCCGTGATACTGGAAGCTGGTAAGAGATCCGC...

CDS

Download CDS FASTA

1338 bp · TkA08G084120|TK1151|CDS

ATGGTGCACCCAACACCTTCAATGGCCAAACAGCTTCGCTTTTCCGATCACTCAACTGAAGTTCCCAAGCGTAATTACGATCAATTAAACATCGACTCGATACTTGAATCCCTGTTTGCTGTTTCCGATTACGGTTTAATCGACGCCTCATTCGATGGCCTGGTCAAATCTAGGTCTAGCGATTCCCACCAAGACGATTTTATCCAACGTGCTCTCCACCTCGGATCCGTGATACTGGAAGCTGGTAAGAGATCCGCTCG...

Protein

Download Protein FASTA

445 aa · TkA08G084120|TK1151|PROTEIN

MVHPTPSMAKQLRFSDHSTEVPKRNYDQLNIDSILESLFAVSDYGLIDASFDGLVKSRSSDSHQDDFIQRALHLGSVILEAGKRSARKRSSVHNASVWPLPPHLTIKVFSMLDTTSVWSATATCLFFQKCAKDPFCYTNIDLAALVPKMRPKIIVPKINARVSTMIEQAGNALQSLKLCGPYYDEVATQEEMLPIFTCSCLSSLSANGGAPGSHLKRLHLYNIGVPDGWEDATFVTKKISASLTVCPSLVEIKIVSTDVH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G084120`
TK1151 ID	TkA08G084120
OH-1004 ID	LXL04_018814
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G084120

Location Chr08:21666171-21670487 (+)

Description Similar to SKIP17: F-box protein SKIP17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02740`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018814 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT4G02733

ath:AT4G02740

ath:AT4G02760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · TkA08G084120 · TK1151

Cytoplasm0.180

Rank 2 · TkA08G084120 · TK1151

Cell membrane0.042

Rank 3 · TkA08G084120 · TK1151

Mitochondrion0.030

Rank 4 · TkA08G084120 · TK1151

Plastid0.026

Rank 5 · TkA08G084120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like100-142 aa

PF29594LRR_SKP2162-204 aa

PF29594LRR_SKP2237-367 aa

PF12937F-box-like279-297 aa

PF29594LRR_SKP2364-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G084120	`PF12937`	F-box-like	100	142	1.2e-05	25.7
TkA08G084120	`PF29594`	LRR_SKP2	162	204	7.9e-07	29.3
TkA08G084120	`PF29594`	LRR_SKP2	237	367	7.9e-07	29.3
TkA08G084120	`PF12937`	F-box-like	279	297	1.2e-05	25.7
TkA08G084120	`PF29594`	LRR_SKP2	364	403	7.9e-07	29.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WRC9`	Arabidopsis thaliana	sp\|Q0WRC9\|SKI17_ARATH F-box protein SKIP17	35.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card