TkA08G080180 | RubberDandelionOmics

Gene overview

TkA08G080180

Reference: TK1151 Chr: Chr08 Coordinates: 20577155-20580893 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2164 bp · TkA08G080180|TK1151|cDNA

TTAATACCAGTAAGTGTTTTTCAAAACATTTAAAAATTAAATACAAATAAAAAGAGAAACCGAAGAATAACGACACCTGCCTTTCTCTCTTTGTTTTCTTTCATTCTTCCATTTTCGCATATCCATCCTTCATTACATATCCTCCCTCCTCCCTCTGCCATTTCTGTCTCTCTATCGGATTCTGTTTTCCGGCACAAATTCATCGCAATCCATTCCTCCTTTCGTCATCAGCGATTCACCGATCGTCATTCAATCGCCCG...

CDS

Download CDS FASTA

1143 bp · TkA08G080180|TK1151|CDS

ATGCTTCTTCAAGGAGGAACTGGAGTACCTAGTCTGAAGTGGTTTGGAGTTGAGGGAGAGTACAATATCATGGTGATTGACCTTCTTGGACCAAGTCTTGAAGATCTTTTCAACTATTGTAATAGAAAGTTTACCTTGAAGACAGTTCTAATGCTTGCAGATCAACTAATAAATAGAGTTGAGTTCATGCATGCAAGGAGTTTTCTTCACCGGGACCTAAAGCCTGACAATTTTTTAATGGGCCTGGGCCGCAAAGCAAA...

Protein

Download Protein FASTA

380 aa · TkA08G080180|TK1151|PROTEIN

MLLQGGTGVPSLKWFGVEGEYNIMVIDLLGPSLEDLFNYCNRKFTLKTVLMLADQLINRVEFMHARSFLHRDLKPDNFLMGLGRKANQVYVIDFGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKMLTPIEVLCKSYPPEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQIGASSRERPQSGNAGQHVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G080180`
TK1151 ID	TkA08G080180
OH-1004 ID	LXL04_018735
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 87.156 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G080180

Location Chr08:20577155-20580893 (-)

Description Similar to CKL10: Casein kinase 1-like protein 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23340`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g14340`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At4g28540`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Arabidopsis casein kinase 1-like 6 contains a microtubule-binding domain and affects the organization of cortical microtubules,2008 · DOI: 10.1104/pp.108.129346 Versatile casein kinase 1: multiple locations and functions.2009 · DOI: 10.1104/pp.108.129346
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g43320`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018735 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0016310 phosphorylation Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G03930

ath:AT3G23340

ath:AT4G14340

ath:AT4G28540

ath:AT5G43320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.599

Rank 1 · TkA08G080180 · TK1151

Nucleus0.412

Rank 2 · TkA08G080180 · TK1151

Cell membrane0.100

Rank 3 · TkA08G080180 · TK1151

Mitochondrion0.066

Rank 4 · TkA08G080180 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA08G080180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr20-214 aa

PF00069Pkinase24-171 aa

PF03109ABC130-102 aa

PF05445Pox_ser-thr_kin46-80 aa

PF06293Kdo56-98 aa

PF17667Pkinase_fungal60-150 aa

PF01636APH64-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G080180	`PF07714`	PK_Tyr_Ser-Thr	20	214	7.5e-09	36.0
TkA08G080180	`PF00069`	Pkinase	24	171	9.6e-17	62.0
TkA08G080180	`PF03109`	ABC1	30	102	0.011	15.6
TkA08G080180	`PF05445`	Pox_ser-thr_kin	46	80	0.15	11.7
TkA08G080180	`PF06293`	Kdo	56	98	0.011	15.9
TkA08G080180	`PF17667`	Pkinase_fungal	60	150	1e-07	31.8
TkA08G080180	`PF01636`	APH	64	97	0.00055	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW62`	Arabidopsis thaliana	sp\|Q9LW62\|CKL10_ARATH Casein kinase 1-like protein 10	70.300%	Swiss-Prot	High
`Q39050`	Arabidopsis thaliana	sp\|Q39050\|CKL11_ARATH Casein kinase 1-like protein 11	69.600%	Swiss-Prot	High
`Q8LPJ1`	Arabidopsis thaliana	sp\|Q8LPJ1\|CKL6_ARATH Casein kinase 1-like protein 6	67.200%	Swiss-Prot	High
`Q9ZWB3`	Arabidopsis thaliana	sp\|Q9ZWB3\|CKL9_ARATH Casein kinase 1-like protein 9	66.800%	Swiss-Prot	High
`Q9LSX4`	Arabidopsis thaliana	sp\|Q9LSX4\|CKL8_ARATH Casein kinase 1-like protein 8	66.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card