Gene Card
Gene overview
cDNA / CDS / Protein Sequences
333 bp · TkA08G079970|TK1151|cDNA
ATGGAAGGTTTGAAGGAAACAGAAGCAGGAACATCATCTGGGTCTTCTTCACTTCTTGATGATGTTAATGGAGATTTCAAGAACAAACAATTTACAGAAAATCCATTAAATATTAGGGTTTATGAACATGATGATGATGATGAAGATGATGAACATGAACATCATCAAGATGGTGTTTCCAAATTTGTTCCTGGCATTCTCTTCCTCTTAAGGATCAGCTTGACAAGGACAAGGTTTGATTTTTATATCTTTTACTTTAT...
333 bp · TkA08G079970|TK1151|CDS
ATGGAAGGTTTGAAGGAAACAGAAGCAGGAACATCATCTGGGTCTTCTTCACTTCTTGATGATGTTAATGGAGATTTCAAGAACAAACAATTTACAGAAAATCCATTAAATATTAGGGTTTATGAACATGATGATGATGATGAAGATGATGAACATGAACATCATCAAGATGGTGTTTCCAAATTTGTTCCTGGCATTCTCTTCCTCTTAAGGATCAGCTTGACAAGGACAAGGTTTGATTTTTATATCTTTTACTTTAT...
Protein
Download Protein FASTA110 aa · TkA08G079970|TK1151|PROTEIN
MEGLKETEAGTSSGSSSLLDDVNGDFKNKQFTENPLNIRVYEHDDDDEDDEHEHHQDGVSKFVPGILFLLRISLTRTRFDFYIFYFICKFFKDYKFFMSNFFSYIIFSYF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G079970 |
|---|---|
| TK1151 ID | TkA08G079970 |
| OH-1004 ID | LXL04_018722 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 87.500 |
| Protein coverage (%) | TK1151 72.727 / OH-1004 33.755Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G079970 |
|---|---|
| Location | Chr08:20526658-20526990 (-) |
| Description | Similar to GDI1: Rho GDP-dissociation inhibitor 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0000902 cell morphogenesis Biological Process GO:0006907 pinocytosis Biological Process GO:0007266 Rho protein signal transduction Biological Process GO:0008360 regulation of cell shape Biological Process GO:0009617 response to bacterium Biological Process GO:0009932 cell tip growth Biological Process GO:0010053 root epidermal cell differentiation Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0030336 negative regulation of cell migration Biological Process GO:0032880 regulation of protein localization Biological Process GO:0035023 regulation of Rho protein signal transduction Biological Process |
| KEGG gene cross-reference | ath:AT3G07880 ddi:DDB_G0291077 hsa:396 mcf:101866857 rno:360678 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.