TkA08G079960 | RubberDandelionOmics

Gene overview

TkA08G079960

Reference: TK1151 Chr: Chr08 Coordinates: 20525487-20526179 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA08G079960|TK1151|cDNA

ATGATTTTTTTTTTGCAATTTATTGTTTTGGTTTTACAGGATGATGAAAGTTTAAGGAGGTGGAAAGAGAAGTTGCTTGGTGGTGTCGAAAGCGATTTGTATGGGCAAAAAGACCCCGAAGTTAAATTCCACTCCATAGGAATCGTATCAAAGGACATTGGTGAGATCACAACTTCATTACCGGTCAAAGAAAGTCAAAGTGGCCGCCCCCTTTTTACTCTTAAAGAAGGAGTTCAGTATCGGCTTAAGCTAACATTCAC...

CDS

Download CDS FASTA

474 bp · TkA08G079960|TK1151|CDS

ATGATTTTTTTTTTGCAATTTATTGTTTTGGTTTTACAGGATGATGAAAGTTTAAGGAGGTGGAAAGAGAAGTTGCTTGGTGGTGTCGAAAGCGATTTGTATGGGCAAAAAGACCCCGAAGTTAAATTCCACTCCATAGGAATCGTATCAAAGGACATTGGTGAGATCACAACTTCATTACCGGTCAAAGAAAGTCAAAGTGGCCGCCCCCTTTTTACTCTTAAAGAAGGAGTTCAGTATCGGCTTAAGCTAACATTCAC...

Protein

Download Protein FASTA

157 aa · TkA08G079960|TK1151|PROTEIN

MIFFLQFIVLVLQDDESLRRWKEKLLGGVESDLYGQKDPEVKFHSIGIVSKDIGEITTSLPVKESQSGRPLFTLKEGVQYRLKLTFTVLHNIVSGLTYTNTVWKSGIQVDRIKGMLGTFAPQKDAYVEMLEEETTPSGILARGIYTAKLRVSYVLNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G079960`
TK1151 ID	TkA08G079960
OH-1004 ID	LXL04_018722
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 87.898 / OH-1004 58.228 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G079960

Location Chr08:20525487-20526179 (-)

Description Similar to GDI1: Rho GDP-dissociation inhibitor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07880`	Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018722 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000902 cell morphogenesis Biological Process

GO:0006907 pinocytosis Biological Process

GO:0007266 Rho protein signal transduction Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030336 negative regulation of cell migration Biological Process

GO:0032880 regulation of protein localization Biological Process

GO:0035023 regulation of Rho protein signal transduction Biological Process

KEGG gene cross-reference

ath:AT3G07880

ddi:DDB_G0291077

hsa:396

mcf:101866857

rno:360678

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.423

Rank 1 · TkA08G079960 · TK1151

Endoplasmic reticulum0.397

Rank 2 · TkA08G079960 · TK1151

Nucleus0.199

Rank 3 · TkA08G079960 · TK1151

Golgi apparatus0.153

Rank 4 · TkA08G079960 · TK1151

Cell membrane0.111

Rank 5 · TkA08G079960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02115Rho_GDI11-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G079960	`PF02115`	Rho_GDI	11	150	5.3e-51	173.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFC6`	Arabidopsis thaliana	sp\|Q9SFC6\|GDIR_ARATH Rho GDP-dissociation inhibitor 1	53.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card