Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1288 bp · TkA08G079880|TK1151|cDNA
AATTGACTAGTATATTCATACAAAACCGCAACACTTAAAGCTCTTTTAAGAAAACGAGTGAAAAATTTGGAGCTTATATTTGCTGGAAAGAAACGTAAATTGCTGAAACGGCGGCGTTTATGGGGCGACCGTATCTCCCAACAAATACTACTTTTTCCGGGAAGTGGTGGCACTCGGAATTAGCACACAAACCCTAACCCTAAATTCAAACACTGCAACTCAGGGTTTCTGTGCGAGAAATAAACCGGTGTTAATGGAGT...
1035 bp · TkA08G079880|TK1151|CDS
ATGGAGTCAGACGAAGGGAAGCTGTTCATCGGAGGGATAGCATGGGACACCACCGAGGAAACCCTCAGCGATTACTTCAGCAAGTACGGCGCTGTCTCGCAGACTGTAATCATGCGCGACAAGACCACCGGCCGTCCACGTGGCTTCGGCTTCGTCGTTTTCTCAGATCCTTCCGTTCTTGATTCTGTTCTTCAAGATAGGCACACTATTGAGGGCCGAACTGTGGAAGCTAAGAGAGCTTTGTCCAGGGAAGAACAGCA...
Protein
Download Protein FASTA345 aa · TkA08G079880|TK1151|PROTEIN
MESDEGKLFIGGIAWDTTEETLSDYFSKYGAVSQTVIMRDKTTGRPRGFGFVVFSDPSVLDSVLQDRHTIEGRTVEAKRALSREEQQTSRPANNAGRSSGVTGNYRTKKIFVGGLPSTLTEDQFRQHFETYGDITDVVIMIDQTTNRPRGFGFISFDTEDSVDRVLQKTFHELNNKVVEVKRALPKDANPGGSGGGGRGGGYQGGNSGLYDSQMDGNRFMQQATGGGGYPAYSGYGQLGYGYGAGYGSYGGGGGYGGATA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G079880 |
|---|---|
| TK1151 ID | TkA08G079880 |
| OH-1004 ID | LXL04_036833 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 79.500 |
| Protein coverage (%) | TK1151 67.826 / OH-1004 62.895Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G079880 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:20507201-20508657 (+) | |||||||||
| Description | Similar to RNP1: Heterogeneous nuclear ribonucleoprotein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006397 mRNA processing Biological Process GO:0006417 regulation of translation Biological Process GO:0008380 RNA splicing Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0048864 stem cell development Biological Process GO:0051028 mRNA transport Biological Process GO:1901000 regulation of response to salt stress Biological Process GO:2000070 regulation of response to water deprivation Biological Process GO:0005634 nucleus Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G58470 ath:AT4G14300 cel:CELE_R10E9.1 mmu:76626 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16367RRM_77-69 aaPF00076RRM_18-75 aaPF14703PHM7_cyt9-38 aaPF28441RRM_1112-87 aaPF23085RRM_PARP14_315-76 aaPF25015RBD_AKAP-17A18-42 aaPF14703PHM7_cyt38-67 aaPF23222RRM_PARP14_147-71 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G079880 | PF16367 | RRM_7 | 7 | 69 | 1.1e-16 | 61.2 |
| TkA08G079880 | PF00076 | RRM_1 | 8 | 75 | 2.6e-36 | 124.0 |
| TkA08G079880 | PF14703 | PHM7_cyt | 9 | 38 | 0.053 | 14.5 |
| TkA08G079880 | PF28441 | RRM_11 | 12 | 87 | 9.2e-09 | 36.3 |
| TkA08G079880 | PF23085 | RRM_PARP14_3 | 15 | 76 | 1.5e-10 | 41.8 |
| TkA08G079880 | PF25015 | RBD_AKAP-17A | 18 | 42 | 0.19 | 11.9 |
| TkA08G079880 | PF14703 | PHM7_cyt | 38 | 67 | 0.053 | 14.5 |
| TkA08G079880 | PF23222 | RRM_PARP14_1 | 47 | 71 | 0.07 | 13.7 |
| TkA08G079880 | PF23085 | RRM_PARP14_3 | 107 | 181 | 1.5e-10 | 41.8 |
| TkA08G079880 | PF16367 | RRM_7 | 108 | 181 | 1.1e-16 | 61.2 |
| TkA08G079880 | PF00076 | RRM_1 | 110 | 177 | 2.6e-36 | 124.0 |
| TkA08G079880 | PF14703 | PHM7_cyt | 110 | 135 | 0.053 | 14.5 |
| TkA08G079880 | PF28441 | RRM_11 | 113 | 185 | 9.2e-09 | 36.3 |
| TkA08G079880 | PF25015 | RBD_AKAP-17A | 120 | 147 | 0.19 | 11.9 |
| TkA08G079880 | PF14703 | PHM7_cyt | 143 | 172 | 0.053 | 14.5 |
| TkA08G079880 | PF23222 | RRM_PARP14_1 | 150 | 175 | 0.07 | 13.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.