TkA08G078430 | RubberDandelionOmics

Gene overview

TkA08G078430

Reference: TK1151 Chr: Chr08 Coordinates: 20151396-20152270 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA08G078430|TK1151|cDNA

TTTCAGCTCAAAGAACTTGAAAAATTGGGCCCTAGAAAAGACGTCATCGGCCAATCTGTCAAAGATGTTGTCCAAACTCTAGTGGATGATGACTTGGTCTCAAAAGACAAGATAGGAACCTCGGTATACTTTTGGAGTCTTCCTAATTGTGCTGGAAACCAGCTAAGAAATATGTCTAAGAAACTTCAGTCAGACCTTGAAATCAGCAAGAAGCGGCATACAGAACTTGTGGAACAATGTGAATCCCTTAAAAAAGGCAG...

CDS

Download CDS FASTA

393 bp · TkA08G078430|TK1151|CDS

TTTCAGCTCAAAGAACTTGAAAAATTGGGCCCTAGAAAAGACGTCATCGGCCAATCTGTCAAAGATGTTGTCCAAACTCTAGTGGATGATGACTTGGTCTCAAAAGACAAGATAGGAACCTCGGTATACTTTTGGAGTCTTCCTAATTGTGCTGGAAACCAGCTAAGAAATATGTCTAAGAAACTTCAGTCAGACCTTGAAATCAGCAAGAAGCGGCATACAGAACTTGTGGAACAATGTGAATCCCTTAAAAAAGGCAG...

Protein

Download Protein FASTA

130 aa · TkA08G078430|TK1151|PROTEIN

FQLKELEKLGPRKDVIGQSVKDVVQTLVDDDLVSKDKIGTSVYFWSLPNCAGNQLRNMSKKLQSDLEISKKRHTELVEQCESLKKGREDSDAREEALSEFKAIEQKYNNLKEELGQYADNDPATFEAMSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G078430`
TK1151 ID	TkA08G078430
OH-1004 ID	LXL04_018698
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.462 / OH-1004 96.970 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G078430

Location Chr08:20151396-20152270 (+)

Description Similar to MND1: Meiotic nuclear division protein 1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29170`	Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis.	The Arabidopsis thaliana MND1 homologue plays a key role in meiotic homologous pairing, synapsis and recombination.2006 · DOI: 10.1242/jcs.02967 AtMND1 is required for homologous pairing during meiosis in Arabidopsis.2006 · DOI: 10.1186/1471-2199-7-24 The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana.2007 · DOI: 10.1371/journal.pgen.0030176

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018698 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000709 meiotic joint molecule formation Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010774 meiotic strand invasion involved in reciprocal meiotic recombination Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G29170

dre:445203

hsa:84057

mmu:76915

spo:2542548

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.770

Rank 1 · TkA08G078430 · TK1151

Cytoplasm0.307

Rank 2 · TkA08G078430 · TK1151

Mitochondrion0.031

Rank 3 · TkA08G078430 · TK1151

Cell membrane0.025

Rank 4 · TkA08G078430 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA08G078430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03962Mnd11-48 aa

PF03908Sec2021-33 aa

PF03993DUF34949-110 aa

PF03938OmpH51-115 aa

PF03961FapA53-119 aa

PF23435DUF712153-117 aa

PF03908Sec2053-109 aa

PF26052BRE1B53-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G078430	`PF03962`	Mnd1	1	48	7e-20	71.8
TkA08G078430	`PF03908`	Sec20	21	33	0.16	12.6
TkA08G078430	`PF03993`	DUF349	49	110	0.068	14.3
TkA08G078430	`PF03938`	OmpH	51	115	0.07	14.0
TkA08G078430	`PF03961`	FapA	53	119	0.0021	18.4
TkA08G078430	`PF23435`	DUF7121	53	117	0.018	15.2
TkA08G078430	`PF03908`	Sec20	53	109	0.16	12.6
TkA08G078430	`PF26052`	BRE1B	53	91	0.23	11.9
TkA08G078430	`PF28907`	ZapB_rel	53	85	1.1	10.6
TkA08G078430	`PF06419`	COG6_N	54	102	0.0098	16.7
TkA08G078430	`PF30744`	Pex17	55	128	0.086	13.4
TkA08G078430	`PF03962`	Mnd1	57	74	7e-20	71.8
TkA08G078430	`PF13256`	DUF4047	60	115	0.0032	18.2
TkA08G078430	`PF10279`	Latarcin	64	118	0.26	12.3
TkA08G078430	`PF21717`	DTX3L_a-b	68	114	0.015	15.9
TkA08G078430	`PF04325`	DUF465	71	97	0.036	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYD2`	Arabidopsis thaliana	sp\|Q8GYD2\|MND1_ARATH Meiotic nuclear division protein 1 homolog	67.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card