TkA08G077630 | RubberDandelionOmics

Gene overview

TkA08G077630

Reference: TK1151 Chr: Chr08 Coordinates: 19898187-19899883 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1626 bp · TkA08G077630|TK1151|cDNA

GTTCTAATTTATTTTTTTCATAATCGTCTTCTCTTTCCTCCTACATAACAAATTCAAATCCAAATCCAATCCTTCCATGAAAATGAATCAAGTAATGGTGATGCCTTACCCAGGCAGAGGCCACATAAACCCTCTGTTAAACCTCTGCCACGTGCTCTCTTATAAAAATCTCACCACCGTCTTCACCGTCGTCCTCACGGAAGAGTGGTCGGAACTCATCGGCTCCGATCCGAAGCCTCATAACCTCCGGTTCGCAACCA...

CDS

Download CDS FASTA

1293 bp · TkA08G077630|TK1151|CDS

ATGAAAATGAATCAAGTAATGGTGATGCCTTACCCAGGCAGAGGCCACATAAACCCTCTGTTAAACCTCTGCCACGTGCTCTCTTATAAAAATCTCACCACCGTCTTCACCGTCGTCCTCACGGAAGAGTGGTCGGAACTCATCGGCTCCGATCCGAAGCCTCATAACCTCCGGTTCGCAACCATCCCCAATGTTATACCTTCAGATATTAACCGCGGGACTGACCCTATTGGATTCTTCATTGCTGCTCAGAATAACAT...

Protein

Download Protein FASTA

430 aa · TkA08G077630|TK1151|PROTEIN

MKMNQVMVMPYPGRGHINPLLNLCHVLSYKNLTTVFTVVLTEEWSELIGSDPKPHNLRFATIPNVIPSDINRGTDPIGFFIAAQNNMEIPFDLLLDDMEQPVNLIIADATLKWTLNVGIRRNIPVAAYWPMSASMFTMWYHVDLLQEHQHIYVDLSERGEEYIDYIPGLSPIKAADFPVVDRGLHDILPNLVSLGNKSQSLLLATGYDLEPKAIDAIKHKLKIPVYTFSPNFPLEPTSNLHNHGYFSWLNSKPRGSVLYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G077630`
TK1151 ID	TkA08G077630
OH-1004 ID	LXL04_018673
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G077630

Location Chr08:19898187-19899883 (-)

Description Similar to UGT87A2: UDP-glycosyltransferase 87A2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30140`	UDP-glycosyltransferase 87A2.	No verified direct reference in this release
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release
`At1g78270`	UDP-glycosyltransferase 85A4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0015020 glucuronosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G78270

ath:AT2G28080

ath:AT2G30140

ath:AT2G30150

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.770

Rank 1 · TkA08G077630 · TK1151

Nucleus0.222

Rank 2 · TkA08G077630 · TK1151

Peroxisome0.078

Rank 3 · TkA08G077630 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA08G077630 · TK1151

Plastid0.046

Rank 5 · TkA08G077630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N6-36 aa

PF26168Glyco_transf_N210-234 aa

PF00201UDPGT250-363 aa

PF07249Cerato-platanin299-332 aa

PF12879SICA_C368-418 aa

PF19012DUF5741389-418 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G077630	`PF26168`	Glyco_transf_N	6	36	0.0018	18.9
TkA08G077630	`PF26168`	Glyco_transf_N	210	234	0.0018	18.9
TkA08G077630	`PF00201`	UDPGT	250	363	1.4e-17	64.4
TkA08G077630	`PF07249`	Cerato-platanin	299	332	0.22	12.4
TkA08G077630	`PF12879`	SICA_C	368	418	0.66	10.7
TkA08G077630	`PF19012`	DUF5741	389	418	0.74	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64733`	Arabidopsis thaliana	sp\|O64733\|U87A2_ARATH UDP-glycosyltransferase 87A2	46.500%	Swiss-Prot	Medium
`O64732`	Arabidopsis thaliana	sp\|O64732\|U87A1_ARATH UDP-glycosyltransferase 87A1	44.300%	Swiss-Prot	Medium
`Q9ZUV0`	Arabidopsis thaliana	sp\|Q9ZUV0\|U86A2_ARATH UDP-glycosyltransferase 86A2	30.300%	Swiss-Prot	Medium
`Q9SJL0`	Arabidopsis thaliana	sp\|Q9SJL0\|U86A1_ARATH UDP-glycosyltransferase 86A1	28.400%	Swiss-Prot	Low
`Q9M9E7`	Arabidopsis thaliana	sp\|Q9M9E7\|U85A4_ARATH UDP-glycosyltransferase 85A4	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card