TkA08G076840 | RubberDandelionOmics

Gene overview

TkA08G076840

Reference: TK1151 Chr: Chr08 Coordinates: 19720014-19720532 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA08G076840|TK1151|cDNA

ATGGGGAGGAATACGGCACCACTACCATCAGAAAAATCAACGGAGGACAGACTCAGTGATTTACCGGTTGCATTACAGATTCACATTCTCAGTTATCTCGACGCAAAACACGCCGTTCAAGCATCATCACTGTCAAAACCTTGGGCCAATTTGTGGACTCGGATCCCCGTTTTCGATTTCAACTACTTAGCTTTCACCGACCTCGATAAATTCGAGCCGTTTGTCCGTAGGGTTTTATCGGAACGCGATGATATAGCCAA...

CDS

Download CDS FASTA

519 bp · TkA08G076840|TK1151|CDS

ATGGGGAGGAATACGGCACCACTACCATCAGAAAAATCAACGGAGGACAGACTCAGTGATTTACCGGTTGCATTACAGATTCACATTCTCAGTTATCTCGACGCAAAACACGCCGTTCAAGCATCATCACTGTCAAAACCTTGGGCCAATTTGTGGACTCGGATCCCCGTTTTCGATTTCAACTACTTAGCTTTCACCGACCTCGATAAATTCGAGCCGTTTGTCCGTAGGGTTTTATCGGAACGCGATGATATAGCCAA...

Protein

Download Protein FASTA

172 aa · TkA08G076840|TK1151|PROTEIN

MGRNTAPLPSEKSTEDRLSDLPVALQIHILSYLDAKHAVQASSLSKPWANLWTRIPVFDFNYLAFTDLDKFEPFVRRVLSERDDIAKLDTVKFNAPEISSLKTLKEVFDYAIKHGVKQLEASIERVGGFTSSWPTVPVSDSLTSLKLHSEWVRSGVRFLDQIHRSRMSLFCI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G076840`
TK1151 ID	TkA08G076840
OH-1004 ID	LXL04_018658
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 73.256 / OH-1004 70.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G076840

Location Chr08:19720014-19720532 (-)

Description Similar to At5g22730: FBD-associated F-box protein At5g22730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At3g26920`	F-box/FBD/LRR-repeat protein At3g26920.	No verified direct reference in this release
`At1g32375`	Probable FBD-associated F-box protein At1g32375.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018658 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT5G18780

ath:AT5G22730

ath:AT5G53840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.553

Rank 1 · TkA08G076840 · TK1151

Cytoplasm0.461

Rank 2 · TkA08G076840 · TK1151

Endoplasmic reticulum0.076

Rank 3 · TkA08G076840 · TK1151

Cell membrane0.066

Rank 4 · TkA08G076840 · TK1151

Mitochondrion0.034

Rank 5 · TkA08G076840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09372PRANC15-36 aa

PF00646F-box18-56 aa

PF12937F-box-like18-51 aa

PF09372PRANC46-57 aa

PF09372PRANC111-137 aa

PF00646F-box157-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G076840	`PF09372`	PRANC	15	36	0.23	12.5
TkA08G076840	`PF00646`	F-box	18	56	1.8e-07	31.5
TkA08G076840	`PF12937`	F-box-like	18	51	3.4e-05	24.2
TkA08G076840	`PF09372`	PRANC	46	57	0.23	12.5
TkA08G076840	`PF09372`	PRANC	111	137	0.23	12.5
TkA08G076840	`PF00646`	F-box	157	171	1.8e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJF8`	Arabidopsis thaliana	sp\|Q9LJF8\|FBL47_ARATH F-box/LRR-repeat protein At3g26922	34.800%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	43.900%	Swiss-Prot	Low
`Q9LJF9`	Arabidopsis thaliana	sp\|Q9LJF9\|FDL44_ARATH F-box/FBD/LRR-repeat protein At3g26920	43.300%	Swiss-Prot	Low
`Q9LQM1`	Arabidopsis thaliana	sp\|Q9LQM1\|FBD39_ARATH Probable FBD-associated F-box protein At1g32375	39.500%	Swiss-Prot	Low
`Q8LF09`	Arabidopsis thaliana	sp\|Q8LF09\|FDL23_ARATH F-box/FBD/LRR-repeat protein At4g00160	31.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card