TkA08G076410 | RubberDandelionOmics

Gene overview

TkA08G076410

Reference: TK1151 Chr: Chr08 Coordinates: 19619288-19623019 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1859 bp · TkA08G076410|TK1151|cDNA

TTCGCTTCTTCTGCGGATTTGGCTGTTTTATATACCAACACCATTAATCCTTTTTATCTTCTCTCCTGTAATTTCAACGAATTTGTTCTTGCATTGCTGATCTGAATTCCGAATTTTATCAATCTTTATCTTCAAGATCCTGGCGTTATAGTTGATGATACGAAACGTATAAACAAACCGAAGATCATACTGATTAACATGAACGAACTTTCCAACTCTCTCAAATCACGACTCTACTTCAACTAGATCACAATCATTCA...

CDS

Download CDS FASTA

438 bp · TkA08G076410|TK1151|CDS

ATGAAGAGAAAGTATTATGTTTGGGAAGAATGTACGAATTTGCGTGAAGTAAAGTCTCTCAGGAAATTAAATCATCCTAACATCATAAAGCTGAAGGAAATTGTGAGGGAGAATAATGAGTTATTCTTCATATTTGAATACATGGAACATAATTTGTATGATATAATGAGGGAACGTGAAAGGCCATTCACAGAGGAAGAGATTAGGGGTTTGATGACTCAGCTTCTTCAAGGACTTGTACATATGCATAGAAGTGAATA...

Protein

Download Protein FASTA

145 aa · TkA08G076410|TK1151|PROTEIN

MKRKYYVWEECTNLREVKSLRKLNHPNIIKLKEIVRENNELFFIFEYMEHNLYDIMRERERPFTEEEIRGLMTQLLQGLVHMHRSEYFHRDLKPENLLVTNNTIKIADFGLAREVSSSPPLRIMFQLAGIEHQKSCCNLYHTLLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G076410`
TK1151 ID	TkA08G076410
OH-1004 ID	LXL04_000423
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.200
Protein coverage (%)	TK1151 82.759 / OH-1004 34.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G076410

Location Chr08:19619288-19623019 (-)

Description Similar to CDKF-4: Cyclin-dependent kinase F-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13020`	May play a role in the regulation of plant growth and development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0847600`	Cyclin-dependent kinase F-3.	No verified direct reference in this release
`Os02g0700600`	Cyclin-dependent kinase F-4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000423 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0042073 intraciliary transport Biological Process

GO:0045494 photoreceptor cell maintenance Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0060271 cilium assembly Biological Process

GO:1902856 negative regulation of non-motile cilium assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G13020

ddi:DDB_G0268078

dosa:Os02g0700600

dosa:Os03g0847600

mmu:17152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA08G076410 · TK1151

Nucleus0.467

Rank 2 · TkA08G076410 · TK1151

Mitochondrion0.089

Rank 3 · TkA08G076410 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA08G076410 · TK1151

Cell membrane0.057

Rank 5 · TkA08G076410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20541DUF67563-46 aa

PF06293Kdo9-103 aa

PF00069Pkinase11-120 aa

PF07714PK_Tyr_Ser-Thr13-116 aa

PF01163RIO114-112 aa

PF01636APH26-85 aa

PF29080UPF0507_helical28-54 aa

PF05445Pox_ser-thr_kin30-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G076410	`PF20541`	DUF6756	3	46	0.14	12.8
TkA08G076410	`PF06293`	Kdo	9	103	0.092	12.9
TkA08G076410	`PF00069`	Pkinase	11	120	1e-33	117.6
TkA08G076410	`PF07714`	PK_Tyr_Ser-Thr	13	116	1.4e-23	84.3
TkA08G076410	`PF01163`	RIO1	14	112	0.0052	17.1
TkA08G076410	`PF01636`	APH	26	85	0.04	14.4
TkA08G076410	`PF29080`	UPF0507_helical	28	54	0.098	14.1
TkA08G076410	`PF05445`	Pox_ser-thr_kin	30	58	0.055	13.1
TkA08G076410	`PF29986`	CadC_C	30	75	0.065	13.6
TkA08G076410	`PF03109`	ABC1	39	117	5.8e-05	23.1
TkA08G076410	`PF20541`	DUF6756	54	96	0.14	12.8
TkA08G076410	`PF01636`	APH	66	112	0.04	14.4
TkA08G076410	`PF05445`	Pox_ser-thr_kin	83	106	0.055	13.1
TkA08G076410	`PF06293`	Kdo	127	144	0.092	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43294`	Arabidopsis thaliana	sp\|P43294\|MHK_ARATH Serine/threonine-protein kinase MHK	80.000%	Swiss-Prot	High
`Q84SN3`	Oryza sativa subsp. japonica	sp\|Q84SN3\|CDKF3_ORYSJ Cyclin-dependent kinase F-3	73.300%	Swiss-Prot	High
`Q6Z8C8`	Oryza sativa subsp. japonica	sp\|Q6Z8C8\|CDKF4_ORYSJ Cyclin-dependent kinase F-4	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card