TkA08G075720 | RubberDandelionOmics

Gene overview

TkA08G075720

Reference: TK1151 Chr: Chr08 Coordinates: 19462028-19465358 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · TkA08G075720|TK1151|cDNA

TTATTCCTTTTTTCTGCACAAAAAATTCTGCGCTTTTCTTCCGGCAGCAATGGCGACTGATTTCTGGACATCCACACACTACAAACAGTTATTGGACCAAGAAGAAGTAGATACGGTGCACAGCCTTGACAAGGAGCGGGGAATCACACTTGAGGATTTCAAACTCATCAAGTTGCATATGACAAATTATATTGTGCGATTGGCTCAACATGTGAAAGTGAGGCAAAGGGTTGTTGCAACTGCTGTAACATACATGAGAC...

CDS

Download CDS FASTA

756 bp · TkA08G075720|TK1151|CDS

ATGGCGACTGATTTCTGGACATCCACACACTACAAACAGTTATTGGACCAAGAAGAAGTAGATACGGTGCACAGCCTTGACAAGGAGCGGGGAATCACACTTGAGGATTTCAAACTCATCAAGTTGCATATGACAAATTATATTGTGCGATTGGCTCAACATGTGAAAGTGAGGCAAAGGGTTGTTGCAACTGCTGTAACATACATGAGACGTGCTTATACGAGGAGAAGTATGGTGGAATATGATCCACGGTTAGTAGC...

Protein

Download Protein FASTA

251 aa · TkA08G075720|TK1151|PROTEIN

MATDFWTSTHYKQLLDQEEVDTVHSLDKERGITLEDFKLIKLHMTNYIVRLAQHVKVRQRVVATAVTYMRRAYTRRSMVEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLYSDEKYRYEIKEILEMEMKILEALNYYLVVFHPYRALSQLLQDAGMSDSTQMIWGLINDTYKMDLILIYPPHLIALACIYVASMLKDKDNTSWFEQLRVDMNMVEKISTEILDFYDYHKTISEEKVNAAMMKLTMRM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G075720`
TK1151 ID	TkA08G075720
OH-1004 ID	LXL04_018651
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G075720

Location Chr08:19462028-19465358 (-)

Description Similar to CYCC1-2: Cyclin-C1-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48630`	Cyclin-C1-2.	No verified direct reference in this release
`At5g48640`	Cyclin-C1-1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0504400`	Cyclin-C1-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018651 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0045023 G0 to G1 transition Biological Process

GO:0045746 negative regulation of Notch signaling pathway Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0051301 cell division Biological Process

GO:0090209 negative regulation of triglyceride metabolic process Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016592 mediator complex Cellular Component

KEGG gene cross-reference

ath:AT5G48630

ath:AT5G48640

ddi:DDB_G0274139

dosa:Os09g0504400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.799

Rank 1 · TkA08G075720 · TK1151

Cytoplasm0.313

Rank 2 · TkA08G075720 · TK1151

Cell membrane0.027

Rank 3 · TkA08G075720 · TK1151

Mitochondrion0.024

Rank 4 · TkA08G075720 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA08G075720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134Cyclin_N43-142 aa

PF00382TFIIB45-100 aa

PF21797CycT2-like_C45-98 aa

PF16899Cyclin_C_260-115 aa

PF02984Cyclin_C60-106 aa

PF06603UpxZ95-140 aa

PF16899Cyclin_C_2146-198 aa

PF21797CycT2-like_C179-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G075720	`PF00134`	Cyclin_N	43	142	2e-20	73.5
TkA08G075720	`PF00382`	TFIIB	45	100	9.3e-06	26.3
TkA08G075720	`PF21797`	CycT2-like_C	45	98	5.3e-05	23.6
TkA08G075720	`PF16899`	Cyclin_C_2	60	115	0.00015	22.8
TkA08G075720	`PF02984`	Cyclin_C	60	106	0.00034	21.3
TkA08G075720	`PF06603`	UpxZ	95	140	0.059	14.5
TkA08G075720	`PF16899`	Cyclin_C_2	146	198	0.00015	22.8
TkA08G075720	`PF21797`	CycT2-like_C	179	225	5.3e-05	23.6
TkA08G075720	`PF02984`	Cyclin_C	180	229	0.00034	21.3
TkA08G075720	`PF00134`	Cyclin_N	186	207	2e-20	73.5
TkA08G075720	`PF00382`	TFIIB	188	203	9.3e-06	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJK7`	Arabidopsis thaliana	sp\|Q9FJK7\|CCC12_ARATH Cyclin-C1-2	69.900%	Swiss-Prot	High
`Q9FJK6`	Arabidopsis thaliana	sp\|Q9FJK6\|CCC11_ARATH Cyclin-C1-1	68.400%	Swiss-Prot	High
`P93411`	Oryza sativa subsp. japonica	sp\|P93411\|CCC11_ORYSJ Cyclin-C1-1	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card