TkA08G069820 | RubberDandelionOmics

Gene overview

TkA08G069820

Reference: TK1151 Chr: Chr08 Coordinates: 17997274-17999938 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1579 bp · TkA08G069820|TK1151|cDNA

AAGTTCGTTACAAAATTTCGCTCAACATATCAACACCCAAATAAATTGAAGGTCCAAATCCACGCACAATTTCTGAAATTTACAGACTTTGAAATCATTCCCGATCAAAAATTTTAGTTAATCCCATCGCCTTCTCTCAGTATATACATACATGCATGTATATCTACCATCAATCGACATTACCACCGGCGATTTCGTTTGCTTTTGTGTATCGATCGGGAAATAGAAAATCAGGGTCAATGCATTATAGATTTGTGAAA...

CDS

Download CDS FASTA

1071 bp · TkA08G069820|TK1151|CDS

ATGTCGAGCACTGAAGAATCAGACGATTATTCATACGGCGGACGTCGATTTCAGAGGGTGAAACAGAGGCTAAAAGATCGATCAAGGAGAGTCGTCCAAACAAAAGAAAAAACAAAGGAAATATTGTCCAAACAAGCTGTGAAGATCGCCAAACATGCTGAAGAACATGAACGATTCATCACCAAGGTAACTCATTTTATCGGTGTCTTTGCATATGGGGCATTTTGTTTCATATTGGGTGCAAGGCCTCAAGATGTTCG...

Protein

Download Protein FASTA

356 aa · TkA08G069820|TK1151|PROTEIN

MSSTEESDDYSYGGRRFQRVKQRLKDRSRRVVQTKEKTKEILSKQAVKIAKHAEEHERFITKVTHFIGVFAYGAFCFILGARPQDVRYIYILFYITFVPLRWIYYRYKKWHYYLLDFCYYANTLCLIMLLFFPRNQKLFMVTFSFAEGPLAWALIIWRCSLVFSSVDKLVSVLIHLLPGVVFFTLCWWDPEFFEAMYPEGHARGVSWRSVESQSFLCTWLFTVPLFAYALWQVLYFLIVNVLRRQRLLKDPEVMTSYRGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G069820`
TK1151 ID	TkA08G069820
OH-1004 ID	LXL04_018591
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G069820

Location Chr08:17997274-17999938 (+)

Description Similar to GPC1: Glycerophosphocholine acyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35460`	Glycerophosphocholine acyltransferase (GPCAT) that utilizes acyl-CoA to acylate glycero-3-phosphocholine (GPC), forming lysophosphatidylcholine (LPC).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018591 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0036151 phosphatidylcholine acyl-chain remodeling Biological Process

GO:0090640 phosphatidylcholine biosynthesis from sn-glycero-3-phosphocholine Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0071944 cell periphery Cellular Component

GO:0016746 acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G35460

rcu:8272523

sce:YGR149W

spo:2541180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.568

Rank 1 · TkA08G069820 · TK1151

Golgi apparatus0.288

Rank 2 · TkA08G069820 · TK1151

Cell membrane0.158

Rank 3 · TkA08G069820 · TK1151

Cytoplasm0.143

Rank 4 · TkA08G069820 · TK1151

Nucleus0.074

Rank 5 · TkA08G069820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27583BEGAIN_coil16-47 aa

PF04876Tenui_NCP34-95 aa

PF06127Mpo1-like51-172 aa

PF10998DUF283862-171 aa

PF10998DUF2838218-237 aa

PF10998DUF2838283-310 aa

PF06127Mpo1-like301-301 aa

PF04876Tenui_NCP312-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G069820	`PF27583`	BEGAIN_coil	16	47	0.049	14.8
TkA08G069820	`PF04876`	Tenui_NCP	34	95	0.071	13.4
TkA08G069820	`PF06127`	Mpo1-like	51	172	0.034	15.0
TkA08G069820	`PF10998`	DUF2838	62	171	4.1e-37	127.5
TkA08G069820	`PF10998`	DUF2838	218	237	4.1e-37	127.5
TkA08G069820	`PF10998`	DUF2838	283	310	4.1e-37	127.5
TkA08G069820	`PF06127`	Mpo1-like	301	301	0.034	15.0
TkA08G069820	`PF04876`	Tenui_NCP	312	331	0.071	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJB4`	Arabidopsis thaliana	sp\|Q9FJB4\|GPC1_ARATH Glycerophosphocholine acyltransferase 1	68.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card