TkA08G066980 | RubberDandelionOmics

Gene overview

TkA08G066980

Reference: TK1151 Chr: Chr08 Coordinates: 17221002-17223763 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1773 bp · TkA08G066980|TK1151|cDNA

CATGAGAAAGATACCAAAACAATCTGGGTTTGAGCAATTCTAATCAGAGAGAGGAGGAGAGACGGGGTCGCAGCTGTTGATCCTACAAACATAGAAGATATTGAAAGAGAGATCATAACATATCATAGATTAATTAATACACAGAGATTTACACAGAGAGAGAGAGAGGGAGAGAGAGGGAGGGTTTGTTCATCGGTAACAAAACATAACTCCCCCTATCGATCTCCCCCTCTTCTTCAAAAACAAATTTCTTCCATCTG...

CDS

Download CDS FASTA

1134 bp · TkA08G066980|TK1151|CDS

ATGATGATGGGAAGCAATAGCCCGCGCTCCCTTCCTCCTCCGAAGACTAAGAGGCTGTATCAAGTTTGGAAAGGTCGTAATAAATTCTTTTGTGGCGGTAGATTAGTTTTTGGCGCGGATGCTTGTTCAGTGATTTTATCTGCAATCCTTATCGGAGCTCCGGCGATCACCTTCTGCATCAAAATGTACCTCAGTATTAAAAAAAACCCAACCGATTTTGGTCTCGGGGTTTTATGTATAGGAATCATCCTCACATTATT...

Protein

Download Protein FASTA

377 aa · TkA08G066980|TK1151|PROTEIN

MMMGSNSPRSLPPPKTKRLYQVWKGRNKFFCGGRLVFGADACSVILSAILIGAPAITFCIKMYLSIKKNPTDFGLGVLCIGIILTLLDLIFLFMTSASNPGIVRPNKQPPECEESFNFRSQSLNWMNGSVMSMRLPRIKDMLVNGHTIKVKYCDTCMLYRPPRASHCSVCNNCVQRFDHHCPWVGQCIGGRNYRFFLLFITTSTALCVCVFTFSLTDIIRQHGSFWNSLSKDAISVALVVYTFVCVWFVGGLCVFHVFLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G066980`
TK1151 ID	TkA08G066980
OH-1004 ID	LXL04_018543
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G066980

Location Chr08:17221002-17223763 (-)

Description Similar to PAT03: Probable protein S-acyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05070`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g56930`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At2g40990`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g56920`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At3g26935`	Palmitoyl acyltransferase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018543 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0048767 root hair elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0030140 trans-Golgi network transport vesicle Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT2G40990

ath:AT3G26935

ath:AT3G56920

ath:AT3G56930

ath:AT5G05070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.307

Rank 1 · TkA08G066980 · TK1151

Cell membrane0.257

Rank 2 · TkA08G066980 · TK1151

Golgi apparatus0.256

Rank 3 · TkA08G066980 · TK1151

Cytoplasm0.235

Rank 4 · TkA08G066980 · TK1151

Lysosome / Vacuole0.160

Rank 5 · TkA08G066980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05313Pox_P2144-86 aa

PF01529DHHC46-96 aa

PF19632DUF613658-80 aa

PF01529DHHC149-271 aa

PF19632DUF6136195-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G066980	`PF05313`	Pox_P21	44	86	0.14	12.3
TkA08G066980	`PF01529`	DHHC	46	96	1.8e-36	125.9
TkA08G066980	`PF19632`	DUF6136	58	80	0.27	11.2
TkA08G066980	`PF01529`	DHHC	149	271	1.8e-36	125.9
TkA08G066980	`PF19632`	DUF6136	195	257	0.27	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PNZ1`	Arabidopsis thaliana	sp\|Q5PNZ1\|ZDH21_ARATH Probable protein S-acyltransferase 3	56.100%	Swiss-Prot	High
`Q9M1K5`	Arabidopsis thaliana	sp\|Q9M1K5\|ZDH13_ARATH Probable protein S-acyltransferase 4	56.400%	Swiss-Prot	High
`O80685`	Arabidopsis thaliana	sp\|O80685\|ZDHC4_ARATH Probable protein S-acyltransferase 2	56.000%	Swiss-Prot	High
`B3DN87`	Arabidopsis thaliana	sp\|B3DN87\|ZDH12_ARATH Probable protein S-acyltransferase 1	54.700%	Swiss-Prot	High
`Q0WQK2`	Arabidopsis thaliana	sp\|Q0WQK2\|ZDHC9_ARATH Probable protein S-acyltransferase 7	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card