TkA08G066750 | RubberDandelionOmics

Gene overview

TkA08G066750

Reference: TK1151 Chr: Chr08 Coordinates: 17186253-17192387 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1476 bp · TkA08G066750|TK1151|cDNA

AAAGCATACAACATGACAACATTGTGAAAGCGAAATGAGGAATAAAATGTGACTAAAGAGTCCCCCAATCTTGACCTTGAAGTAGTGGTTGGGATTGGGTTTGTCTCAGTGTTACTATTTCATTCCGCTTCCTCCGTCATCTGGCTTCCGATCCTACCTACCACCCCACCAAACCCCATCTACCTTCTAAACCCTATTTTATTCGCAGATCTATATCAGGATTTGTTCTCGGATTTGTCTTTTCCATTCAGGTTCGTTTT...

CDS

Download CDS FASTA

831 bp · TkA08G066750|TK1151|CDS

ATGGATTTACTGGAAGCAAAGGAGATCCAAGTTGGAATTGCTGTTGCCATTGTTGCTGTTGTTGCCACTGCAGCCTACCTTTACACCTCAAAGAAAACCAAAGGAAGCATAGACCCTGAAAACTTTAAGGAATTCAAGCTTGTGAAACGCACACAACTTAGTCACAATGTTGCAAAATTCAGATTTGAGCTTCCTACACCTACTTCAGTATTGGGCCTTCCTATTGGACAGCACATAAGTTGCAGGGGTAAAGATAGTCA...

Protein

Download Protein FASTA

276 aa · TkA08G066750|TK1151|PROTEIN

MDLLEAKEIQVGIAVAIVAVVATAAYLYTSKKTKGSIDPENFKEFKLVKRTQLSHNVAKFRFELPTPTSVLGLPIGQHISCRGKDSQGEEVIKPYTPTTLDTDVGHFELVIKMYPQGRMSHHFREMREGDYMAVRGPKGRFKYQPGQVRAFGMLAGGSGITPMFQVARAILENPKDNTQVHLIYANVTYDDILLKEELEELEAKYPGRFQVYYVLNQPPEEWTGGVGFVSKEMIQAHCPAPASDIKILRCGPPPMNKAMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G066750`
TK1151 ID	TkA08G066750
OH-1004 ID	LXL04_018540
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G066750

Location Chr08:17186253-17192387 (-)

Description Similar to CBR1: NADH--cytochrome b5 reductase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17770`	Reductase transferring electrons from NADH to cytochrome b5.	A mutation in Arabidopsis cytochrome b5 reductase identified by high-throughput screening differentially affects hydroxylation and desaturation.2006 · DOI: 10.1111/j.1365-313x.2006.02925.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018540 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation Biological Process

GO:0017183 protein histidyl modification to diphthamide Biological Process

GO:0022900 electron transport chain Biological Process

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009536 plastid Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016740 transferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G17770

cim:CIMG_05279

ddi:DDB_G0285399

nfi:NFIA_089250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.634

Rank 1 · TkA08G066750 · TK1151

Endoplasmic reticulum0.230

Rank 2 · TkA08G066750 · TK1151

Cytoplasm0.173

Rank 3 · TkA08G066750 · TK1151

Cell membrane0.081

Rank 4 · TkA08G066750 · TK1151

Nucleus0.066

Rank 5 · TkA08G066750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20462DUF67156-56 aa

PF00970FAD_binding_645-143 aa

PF00175NAD_binding_1153-259 aa

PF08030NAD_binding_6153-204 aa

PF20462DUF6715177-204 aa

PF08030NAD_binding_6239-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G066750	`PF20462`	DUF6715	6	56	0.33	11.4
TkA08G066750	`PF00970`	FAD_binding_6	45	143	3e-34	118.0
TkA08G066750	`PF00175`	NAD_binding_1	153	259	5.4e-33	114.6
TkA08G066750	`PF08030`	NAD_binding_6	153	204	0.00026	21.8
TkA08G066750	`PF20462`	DUF6715	177	204	0.33	11.4
TkA08G066750	`PF08030`	NAD_binding_6	239	258	0.00026	21.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZNT1`	Arabidopsis thaliana	sp\|Q9ZNT1\|NB5R1_ARATH NADH--cytochrome b5 reductase 1	81.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card