Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1583 bp · TkA08G066740|TK1151|cDNA
TGAAAAGCCCATATTTTGAACTTGGAGTGGGGTCGCCCTAATGGCGAACATGGCAGGTGGTGGCTCATGATATAAAGCGAGCAAAGGTGCGGCAGAAAGCAGACAACTCCGTGTCGATTGCACACCATTCTGCTTTACTACCCTTGCAGGCAGGCACTAAGGCTTCCCTTAAATCCTCATAAAGAACCGGAGAAGTTGGTGATGAATTGAAGACTATCAAGTGCAGTTCCTTGGAAGCCATGGAACTCTTGAAAAGCAAT...
1134 bp · TkA08G066740|TK1151|CDS
ATGGAACTCTTGAAAAGCAATCTCCCAATGTGCCCTGTAGATCAACATTGCTCACAGTGGGCTAAAAATTACATGAAATACTGTCTATGCACAAAAAAGGATTGGATTTCATTGATATTAGGACTACTCAGTGTTATGAGTTGGGGTGTTGCAGAAGTACCTCAGATTATCACAAATTACAAAACTAAATCTTCAGAAGGACTTGCTATGGGCTTCCTTTTGACATGGATACTCGGAGATCTTTTCAATGTGTTTGGTTG...
Protein
Download Protein FASTA377 aa · TkA08G066740|TK1151|PROTEIN
MELLKSNLPMCPVDQHCSQWAKNYMKYCLCTKKDWISLILGLLSVMSWGVAEVPQIITNYKTKSSEGLAMGFLLTWILGDLFNVFGCLLEPATLPTQYYMAVLYLVTTLALTSQALYYGYFCDQNTSKRKDNKIESADKKTKVNQEESTVPILSKSTPSLPIPSADYSSPPERIYYTSARSLTRSHTPTNFFHRTTTTPICDQDSVHEPLIGATPPPTSQPKTMLCVVFTVGIFLYASNLKLEENSYLDSKSNEGIVIQV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G066740 |
|---|---|
| TK1151 ID | TkA08G066740 |
| OH-1004 ID | LXL04_018539 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 90.408Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G066740 |
|---|---|
| Location | Chr08:17179764-17184081 (-) |
| Description | Similar to RTC2: Probable vacuolar amino acid transporter YPQ3 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0010508 positive regulation of autophagy Biological Process GO:0015819 lysine transport Biological Process GO:0034488 basic amino acid transmembrane export from vacuole Biological Process GO:0080144 intracellular amino acid homeostasis Biological Process GO:0090513 L-histidine transmembrane import into vacuole Biological Process GO:0090517 L-lysine transmembrane import into vacuole Biological Process GO:1903826 L-arginine transmembrane transport Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0016020 membrane Cellular Component |
| KEGG gene cross-reference | cel:CELE_Y43H11AL.2 sce:YBR147W sce:YOL092W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28768OSM11_N13-31 aaPF00810ER_lumen_recept30-85 aaPF04193PQ-loop36-92 aaPF27449LtaS_N77-124 aaPF00810ER_lumen_recept99-114 aaPF28768OSM11_N118-130 aaPF27449LtaS_N224-244 aaPF04193PQ-loop276-334 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G066740 | PF28768 | OSM11_N | 13 | 31 | 0.65 | 11.0 |
| TkA08G066740 | PF00810 | ER_lumen_recept | 30 | 85 | 0.013 | 17.0 |
| TkA08G066740 | PF04193 | PQ-loop | 36 | 92 | 4.1e-34 | 116.9 |
| TkA08G066740 | PF27449 | LtaS_N | 77 | 124 | 10.0 | 6.7 |
| TkA08G066740 | PF00810 | ER_lumen_recept | 99 | 114 | 0.013 | 17.0 |
| TkA08G066740 | PF28768 | OSM11_N | 118 | 130 | 0.65 | 11.0 |
| TkA08G066740 | PF27449 | LtaS_N | 224 | 244 | 10.0 | 6.7 |
| TkA08G066740 | PF04193 | PQ-loop | 276 | 334 | 4.1e-34 | 116.9 |
| TkA08G066740 | PF00810 | ER_lumen_recept | 293 | 318 | 0.013 | 17.0 |
| TkA08G066740 | PF27449 | LtaS_N | 308 | 324 | 10.0 | 6.7 |
| TkA08G066740 | PF27449 | LtaS_N | 351 | 368 | 10.0 | 6.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.