TkA08G066520 | RubberDandelionOmics

Gene overview

TkA08G066520

Reference: TK1151 Chr: Chr08 Coordinates: 17117953-17121524 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2076 bp · TkA08G066520|TK1151|cDNA

AGATTATAATGAAATTGACACTCGTACTTTATTGCCTTTATCACATTATCCGCATATCCAACAAAACCCCTCTTGACTCATGAAAAAGTGGGGCAAAAGATCGAAAATAGGAAAGGTGAAAGAAGAAGGGTGCATTTGTTCGTTTTGAAGAATCAAGATTCAAGATCAGATTTTTGGGCGTGCGATTTCTGTTTTTCCGACTTTAAATTAAACAAATAGCTTCCGAAGTCAGCAGATATATGTATCCAGTTGGAATTTCT...

CDS

Download CDS FASTA

981 bp · TkA08G066520|TK1151|CDS

ATGGGATCAAATGGCCGTGGCGGTGGCGACGGCGACGCCGGTGACGATTCCCAATCCCAACTACCAAAATCACACGAATTGGCAAGACAAGGTTCGTTGTATAACCTAACTTTAGACGAGGTTCAACACCAATTAGGGGATCTCGGAAAACCCTTAACCAGTATGAACCTCGACGAGCTTCTTAAAAGCGTCTGGACAGCTGAAGCCAATCAAGTCACGACAGGTGGAGATGAGGCCGATTACACCCACCATGGTCAACC...

Protein

Download Protein FASTA

326 aa · TkA08G066520|TK1151|PROTEIN

MGSNGRGGGDGDAGDDSQSQLPKSHELARQGSLYNLTLDEVQHQLGDLGKPLTSMNLDELLKSVWTAEANQVTTGGDEADYTHHGQPSLARQSSLNFSHDLRKRTVDEVWQDINKSNNNNKSKSNNNVDKKGTLGEMTLEDFLVKAGIVAGSSPLKKHQQNVNHHHHQQQQQQQWMQYQVAQIPPPPPQQQHVYMTGHHPVQQSLSGVGPMMDLGFHENTQMAISPSHLMHNLSHTQTPGRKRVNSGDVIEKTVERRQKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G066520`
TK1151 ID	TkA08G066520
OH-1004 ID	LXL04_018528
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.746 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G066520

Location Chr08:17117953-17121524 (+)

Description Similar to DPBF3: ABSCISIC ACID-INSENSITIVE 5-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release
`At2g41070`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter.	No verified direct reference in this release
`At1g49720`	Binds to the ABA-responsive element (ABRE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0859300`	May act as a transcription factor with transactivation activity observed in yeast.	A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.2008 · DOI: 10.1007/s11103-008-9298-4 Phosphorylation-mediated regulation of a rice ABA responsive element binding factor.2011 · DOI: 10.1016/j.phytochem.2010.10.005 A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.2012 · DOI: 10.1093/jxb/err338
`Os02g0766700`	Transcriptional activator that mediates abscisic acid (ABA) signaling.	Characterization of OsbZIP23 as a key player of the basic leucine zipper transcription factor family for conferring abscisic acid sensitivity and salinity and drought tolerance in rice.2008 · DOI: 10.1104/pp.108.128199 Feedback Regulation of ABA Signaling and Biosynthesis by a bZIP Transcription Factor Targets Drought-Resistance-Related Genes.2016 · DOI: 10.1104/pp.16.00469 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018528 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010152 pollen maturation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0090332 stomatal closure Biological Process

KEGG gene cross-reference

ath:AT1G49720

ath:AT2G41070

ath:AT3G56850

dosa:Os01g0859300

dosa:Os02g0766700

osa:4325061

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · TkA08G066520 · TK1151

Cytoplasm0.112

Rank 2 · TkA08G066520 · TK1151

Cell membrane0.026

Rank 3 · TkA08G066520 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA08G066520 · TK1151

Mitochondrion0.007

Rank 5 · TkA08G066520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03131bZIP_Maf33-50 aa

PF17213Hydin_ADK90-189 aa

PF28121VPA1267112-174 aa

PF03131bZIP_Maf158-174 aa

PF28121VPA1267250-299 aa

PF07716bZIP_2253-301 aa

PF00170bZIP_1256-299 aa

PF03131bZIP_Maf256-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G066520	`PF03131`	bZIP_Maf	33	50	0.021	16.1
TkA08G066520	`PF17213`	Hydin_ADK	90	189	0.74	10.6
TkA08G066520	`PF28121`	VPA1267	112	174	1.1	10.2
TkA08G066520	`PF03131`	bZIP_Maf	158	174	0.021	16.1
TkA08G066520	`PF28121`	VPA1267	250	299	1.1	10.2
TkA08G066520	`PF07716`	bZIP_2	253	301	4.1e-10	40.3
TkA08G066520	`PF00170`	bZIP_1	256	299	4.3e-12	46.7
TkA08G066520	`PF03131`	bZIP_Maf	256	301	0.021	16.1
TkA08G066520	`PF17213`	Hydin_ADK	263	286	0.74	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LES3`	Arabidopsis thaliana	sp\|Q9LES3\|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2	50.900%	Swiss-Prot	High
`Q9C5Q2`	Arabidopsis thaliana	sp\|Q9C5Q2\|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3	46.100%	Swiss-Prot	Medium
`Q9M7Q5`	Arabidopsis thaliana	sp\|Q9M7Q5\|AI5L4_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 4	35.100%	Swiss-Prot	Medium
`Q8RZ35`	Oryza sativa subsp. japonica	sp\|Q8RZ35\|ABI5_ORYSJ bZIP transcription factor ABI5 homolog	35.400%	Swiss-Prot	Medium
`Q6Z312`	Oryza sativa subsp. japonica	sp\|Q6Z312\|BZP23_ORYSJ bZIP transcription factor 23	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card